Snowpark Migration Accelerator: Release Notes¶
Note that the release notes below are organized by release date. Version numbers for both the application and the conversion core will appear below.
Version 3.1.0 (Feb 27, 2026)¶
Application & CLI Version: 3.1.0¶
Included SMA Core Version¶
Snowpark Conversion Core: 8.1.60
Included SnowConvert AI Version¶
SnowConvert AI Version 2.2.0 (Release Notes)
Engine Release Notes¶
Added¶
Added support for processing files located in a hidden folder (such as
.databrickswhen exported from the source). These files are now correctly processed by the SMA.Added 245 new PySpark elements to the SMA mapping table with a NotSupported status. These entries correspond to functions and methods introduced in PySpark 3.3.0 through 4.1.x:
219 functions (
pyspark.sql.functions)4 DataFrame methods
3 Column methods
5 Session methods
2 ReadWriter methods
12 Types classes
Added new EWIs for the following Pandas elements:
PNDSPY1019: pandas.core.arrays.datetimelike.DatelikeOps.strftime partial support
PNDSPY1020: pandas.core.arrays.datetimelike.TimelikeOps.ceil partial support
PNDSPY1021: pandas.core.arrays.datetimelike.TimelikeOps.floor partial support
PNDSPY1022: pandas.core.arrays.datetimelike.TimelikeOps.round partial support
PNDSPY1023: pandas.core.arrays.datetimes.DatetimeArray.day_name partial support
PNDSPY1024: pandas.core.arrays.datetimes.DatetimeArray.month_name partial support
PNDSPY1025: pandas.core.arrays.datetimes.DatetimeArray.tz_convert partial support
PNDSPY1026: pandas.core.arrays.datetimes.DatetimeArray.tz_localize partial support
PNDSPY1027: pandas.core.base.IndexOpsMixin.argmax partial support
PNDSPY1028: pandas.core.base.IndexOpsMixin.argmin partial support
PNDSPY1029: pandas.core.base.IndexOpsMixin.value_counts partial support
PNDSPY1030: pandas.core.frame.DataFrame.T partial support
PNDSPY1031: pandas.core.frame.DataFrame.__dataframe__ partial support
PNDSPY1032: pandas.core.frame.DataFrame.add partial support
PNDSPY1033: pandas.core.frame.DataFrame.align partial support
PNDSPY1034: pandas.core.frame.DataFrame.all partial support
PNDSPY1035: pandas.core.frame.DataFrame.any partial support
PNDSPY1036: pandas.core.frame.DataFrame.applymap partial support
PNDSPY1037: pandas.core.frame.DataFrame.asfreq partial support
PNDSPY1038: pandas.core.frame.DataFrame.astype partial support
PNDSPY1039: pandas.core.frame.DataFrame.at partial support
PNDSPY1040: pandas.core.frame.DataFrame.backfill partial support
PNDSPY1041: pandas.core.frame.DataFrame.bfill partial support
PNDSPY1042: pandas.core.frame.DataFrame.compare partial support
PNDSPY1043: pandas.core.frame.DataFrame.corr partial support
PNDSPY1044: pandas.core.frame.DataFrame.cumsum partial support
PNDSPY1045: pandas.core.frame.DataFrame.div partial support
PNDSPY1046: pandas.core.frame.DataFrame.divide partial support
PNDSPY1047: pandas.core.frame.DataFrame.dropna partial support
PNDSPY1048: pandas.core.frame.DataFrame.eq partial support
PNDSPY1049: pandas.core.frame.DataFrame.eval partial support
PNDSPY1050: pandas.core.frame.DataFrame.expanding partial support
PNDSPY1051: pandas.core.frame.DataFrame.ffill partial support
PNDSPY1052: pandas.core.frame.DataFrame.fillna partial support
PNDSPY1053: pandas.core.frame.DataFrame.floordiv partial support
PNDSPY1054: pandas.core.frame.DataFrame.from_records partial support
PNDSPY1055: pandas.core.frame.DataFrame.ge partial support
PNDSPY1056: pandas.core.frame.DataFrame.groupby partial support
PNDSPY1057: pandas.core.frame.DataFrame.gt partial support
PNDSPY1058: pandas.core.frame.DataFrame.idxmax partial support
PNDSPY1059: pandas.core.frame.DataFrame.idxmin partial support
PNDSPY1060: pandas.core.frame.DataFrame.info partial support
PNDSPY1061: pandas.core.frame.DataFrame.join partial support
PNDSPY1062: pandas.core.frame.DataFrame.le partial support
PNDSPY1063: pandas.core.frame.DataFrame.loc partial support
PNDSPY1064: pandas.core.frame.DataFrame.lt partial support
PNDSPY1065: pandas.core.frame.DataFrame.map partial support
PNDSPY1066: pandas.core.frame.DataFrame.mask partial support
PNDSPY1067: pandas.core.frame.DataFrame.melt partial support
PNDSPY1068: pandas.core.frame.DataFrame.merge partial support
PNDSPY1069: pandas.core.frame.DataFrame.mod partial support
PNDSPY1070: pandas.core.frame.DataFrame.mul partial support
PNDSPY1071: pandas.core.frame.DataFrame.multiply partial support
PNDSPY1072: pandas.core.frame.DataFrame.ne partial support
PNDSPY1073: pandas.core.frame.DataFrame.nlargest partial support
PNDSPY1074: pandas.core.frame.DataFrame.nsmallest partial support
PNDSPY1075: pandas.core.frame.DataFrame.nunique partial support
PNDSPY1076: pandas.core.frame.DataFrame.pad partial support
PNDSPY1077: pandas.core.frame.DataFrame.pct_change partial support
PNDSPY1078: pandas.core.frame.DataFrame.pivot partial support
PNDSPY1079: pandas.core.frame.DataFrame.pivot_table partial support
PNDSPY1080: pandas.core.frame.DataFrame.pow partial support
PNDSPY1081: pandas.core.frame.DataFrame.quantile partial support
PNDSPY1082: pandas.core.frame.DataFrame.radd partial support
PNDSPY1083: pandas.core.frame.DataFrame.rank partial support
PNDSPY1084: pandas.core.frame.DataFrame.rdiv partial support
PNDSPY1085: pandas.core.frame.DataFrame.reindex partial support
PNDSPY1086: pandas.core.frame.DataFrame.rename partial support
PNDSPY1087: pandas.core.frame.DataFrame.replace partial support
PNDSPY1088: pandas.core.frame.DataFrame.resample partial support
PNDSPY1089: pandas.core.frame.DataFrame.rfloordiv partial support
PNDSPY1090: pandas.core.frame.DataFrame.rmod partial support
PNDSPY1091: pandas.core.frame.DataFrame.rmul partial support
PNDSPY1092: pandas.core.frame.DataFrame.rolling partial support
PNDSPY1093: pandas.core.frame.DataFrame.round partial support
PNDSPY1094: pandas.core.frame.DataFrame.rpow partial support
PNDSPY1095: pandas.core.frame.DataFrame.rsub partial support
PNDSPY1096: pandas.core.frame.DataFrame.rtruediv partial support
PNDSPY1097: pandas.core.frame.DataFrame.sample partial support
PNDSPY1098: pandas.core.frame.DataFrame.shift partial support
PNDSPY1099: pandas.core.frame.DataFrame.skew partial support
PNDSPY1100: pandas.core.frame.DataFrame.sort_index partial support
PNDSPY1101: pandas.core.frame.DataFrame.sort_values partial support
PNDSPY1102: pandas.core.frame.DataFrame.stack partial support
PNDSPY1103: pandas.core.frame.DataFrame.std partial support
PNDSPY1104: pandas.core.frame.DataFrame.sub partial support
PNDSPY1105: pandas.core.frame.DataFrame.subtract partial support
PNDSPY1106: pandas.core.frame.DataFrame.to_csv partial support
PNDSPY1107: pandas.core.frame.DataFrame.transform partial support
PNDSPY1108: pandas.core.frame.DataFrame.transpose partial support
PNDSPY1109: pandas.core.frame.DataFrame.truediv partial support
PNDSPY1110: pandas.core.frame.DataFrame.tz_convert partial support
PNDSPY1111: pandas.core.frame.DataFrame.tz_localize partial support
PNDSPY1112: pandas.core.frame.DataFrame.unstack partial support
PNDSPY1113: pandas.core.frame.DataFrame.var partial support
PNDSPY1114: pandas.core.frame.DataFrame.where partial support
PNDSPY1115: pandas.core.generic.NDFrame.shift partial support
PNDSPY1116: pandas.core.groupby.generic.DataFrameGroupBy.agg partial support
PNDSPY1117: pandas.core.groupby.generic.DataFrameGroupBy.aggregate partial support
PNDSPY1118: pandas.core.groupby.generic.DataFrameGroupBy.fillna partial support
PNDSPY1119: pandas.core.groupby.generic.DataFrameGroupBy.idxmax partial support
PNDSPY1120: pandas.core.groupby.generic.DataFrameGroupBy.idxmin partial support
PNDSPY1121: pandas.core.groupby.generic.DataFrameGroupBy.transform partial support
PNDSPY1122: pandas.core.groupby.generic.DataFrameGroupBy.value_counts partial support
PNDSPY1123: pandas.core.groupby.groupby.BaseGroupBy.get_group partial support
PNDSPY1124: pandas.core.groupby.groupby.GroupBy.all partial support
PNDSPY1125: pandas.core.groupby.groupby.GroupBy.any partial support
PNDSPY1126: pandas.core.groupby.groupby.GroupBy.apply partial support
PNDSPY1127: pandas.core.groupby.groupby.GroupBy.bfill partial support
PNDSPY1128: pandas.core.groupby.groupby.GroupBy.ffill partial support
PNDSPY1129: pandas.core.groupby.groupby.GroupBy.first partial support
PNDSPY1130: pandas.core.groupby.groupby.GroupBy.last partial support
PNDSPY1131: pandas.core.groupby.groupby.GroupBy.pct_change partial support
PNDSPY1132: pandas.core.groupby.groupby.GroupBy.quantile partial support
PNDSPY1133: pandas.core.groupby.groupby.GroupBy.resample partial support
PNDSPY1134: pandas.core.groupby.groupby.GroupBy.rolling partial support
PNDSPY1135: pandas.core.groupby.groupby.GroupBy.shift partial support
PNDSPY1136: pandas.core.groupby.groupby.GroupBy.std partial support
PNDSPY1137: pandas.core.groupby.groupby.GroupBy.var partial support
PNDSPY1138: pandas.core.indexes.base.Index.all partial support
PNDSPY1139: pandas.core.indexes.base.Index.any partial support
PNDSPY1140: pandas.core.indexes.base.Index.nlevels partial support
PNDSPY1141: pandas.core.indexes.base.Index.reindex partial support
PNDSPY1142: pandas.core.indexes.base.Index.sort_values partial support
PNDSPY1143: pandas.core.indexes.datetimes.DatetimeIndex.ceil partial support
PNDSPY1144: pandas.core.indexes.datetimes.DatetimeIndex.day_name partial support
PNDSPY1145: pandas.core.indexes.datetimes.DatetimeIndex.floor partial support
PNDSPY1146: pandas.core.indexes.datetimes.DatetimeIndex.month_name partial support
PNDSPY1147: pandas.core.indexes.datetimes.DatetimeIndex.round partial support
PNDSPY1148: pandas.core.indexes.datetimes.DatetimeIndex.std partial support
PNDSPY1149: pandas.core.indexes.datetimes.DatetimeIndex.tz_convert partial support
PNDSPY1150: pandas.core.indexes.datetimes.DatetimeIndex.tz_localize partial support
PNDSPY1151: pandas.core.indexes.datetimes.bdate_range partial support
PNDSPY1152: pandas.core.indexes.datetimes.date_range partial support
PNDSPY1153: pandas.core.resample.Resampler.asfreq partial support
PNDSPY1154: pandas.core.resample.Resampler.bfill partial support
PNDSPY1155: pandas.core.resample.Resampler.ffill partial support
PNDSPY1156: pandas.core.resample.Resampler.fillna partial support
PNDSPY1157: pandas.core.resample.Resampler.first partial support
PNDSPY1158: pandas.core.resample.Resampler.last partial support
PNDSPY1159: pandas.core.resample.Resampler.quantile partial support
PNDSPY1160: pandas.core.resample.Resampler.std partial support
PNDSPY1161: pandas.core.resample.Resampler.var partial support
PNDSPY1162: pandas.core.reshape.concat.concat partial support
PNDSPY1163: pandas.core.reshape.melt.melt partial support
PNDSPY1164: pandas.core.reshape.merge.merge partial support
PNDSPY1165: pandas.core.reshape.merge.merge_asof partial support
PNDSPY1166: pandas.core.reshape.pivot.crosstab partial support
PNDSPY1167: pandas.core.reshape.pivot.pivot partial support
PNDSPY1168: pandas.core.reshape.pivot.pivot_table partial support
PNDSPY1169: pandas.core.reshape.tile.cut partial support
PNDSPY1170: pandas.core.reshape.tile.qcut partial support
PNDSPY1171: pandas.core.series.Series.add partial support
PNDSPY1172: pandas.core.series.Series.all partial support
PNDSPY1173: pandas.core.series.Series.any partial support
PNDSPY1174: pandas.core.series.Series.case_when partial support
PNDSPY1175: pandas.core.series.Series.compare partial support
PNDSPY1176: pandas.core.series.Series.cumsum partial support
PNDSPY1177: pandas.core.series.Series.div partial support
PNDSPY1178: pandas.core.series.Series.divide partial support
PNDSPY1179: pandas.core.series.Series.dropna partial support
PNDSPY1180: pandas.core.series.Series.eq partial support
PNDSPY1181: pandas.core.series.Series.flags partial support
PNDSPY1182: pandas.core.series.Series.floordiv partial support
PNDSPY1183: pandas.core.series.Series.ge partial support
PNDSPY1184: pandas.core.series.Series.groupby partial support
PNDSPY1185: pandas.core.series.Series.gt partial support
PNDSPY1186: pandas.core.series.Series.le partial support
PNDSPY1187: pandas.core.series.Series.lt partial support
PNDSPY1188: pandas.core.series.Series.map partial support
PNDSPY1189: pandas.core.series.Series.mod partial support
PNDSPY1190: pandas.core.series.Series.mul partial support
PNDSPY1191: pandas.core.series.Series.multiply partial support
PNDSPY1192: pandas.core.series.Series.ne partial support
PNDSPY1193: pandas.core.series.Series.nlargest partial support
PNDSPY1194: pandas.core.series.Series.nsmallest partial support
PNDSPY1195: pandas.core.series.Series.pow partial support
PNDSPY1196: pandas.core.series.Series.quantile partial support
PNDSPY1197: pandas.core.series.Series.radd partial support
PNDSPY1198: pandas.core.series.Series.rdiv partial support
PNDSPY1199: pandas.core.series.Series.reindex partial support
PNDSPY1200: pandas.core.series.Series.rename partial support
PNDSPY1201: pandas.core.series.Series.rfloordiv partial support
PNDSPY1202: pandas.core.series.Series.rmod partial support
PNDSPY1203: pandas.core.series.Series.rmul partial support
PNDSPY1204: pandas.core.series.Series.rpow partial support
PNDSPY1205: pandas.core.series.Series.rsub partial support
PNDSPY1206: pandas.core.series.Series.rtruediv partial support
PNDSPY1207: pandas.core.series.Series.skew partial support
PNDSPY1208: pandas.core.series.Series.sort_index partial support
PNDSPY1209: pandas.core.series.Series.sort_values partial support
PNDSPY1210: pandas.core.series.Series.std partial support
PNDSPY1211: pandas.core.series.Series.sub partial support
PNDSPY1212: pandas.core.series.Series.subtract partial support
PNDSPY1213: pandas.core.series.Series.truediv partial support
PNDSPY1214: pandas.core.series.Series.unstack partial support
PNDSPY1215: pandas.core.series.Series.var partial support
PNDSPY1216: pandas.core.strings.accessor.StringMethods.__getitem__ partial support
PNDSPY1217: pandas.core.strings.accessor.StringMethods.contains partial support
PNDSPY1218: pandas.core.strings.accessor.StringMethods.endswith partial support
PNDSPY1219: pandas.core.strings.accessor.StringMethods.get partial support
PNDSPY1220: pandas.core.strings.accessor.StringMethods.isdigit partial support
PNDSPY1221: pandas.core.strings.accessor.StringMethods.len partial support
PNDSPY1222: pandas.core.strings.accessor.StringMethods.lstrip partial support
PNDSPY1223: pandas.core.strings.accessor.StringMethods.replace partial support
PNDSPY1224: pandas.core.strings.accessor.StringMethods.rstrip partial support
PNDSPY1225: pandas.core.strings.accessor.StringMethods.slice partial support
PNDSPY1226: pandas.core.strings.accessor.StringMethods.split partial support
PNDSPY1227: pandas.core.strings.accessor.StringMethods.startswith partial support
PNDSPY1228: pandas.core.strings.accessor.StringMethods.strip partial support
PNDSPY1229: pandas.core.strings.accessor.StringMethods.translate partial support
PNDSPY1230: pandas.core.tools.datetimes.to_datetime partial support
PNDSPY1231: pandas.core.tools.numeric.to_numeric partial support
PNDSPY1232: pandas.core.tools.timedeltas.to_timedelta partial support
PNDSPY1233: pandas.core.window.ewm.ExponentialMovingWindow.corr partial support
PNDSPY1234: pandas.core.window.ewm.ExponentialMovingWindow.mean partial support
PNDSPY1235: pandas.core.window.ewm.ExponentialMovingWindow.std partial support
PNDSPY1236: pandas.core.window.ewm.ExponentialMovingWindow.sum partial support
PNDSPY1237: pandas.core.window.ewm.ExponentialMovingWindow.var partial support
PNDSPY1238: pandas.core.window.expanding.Expanding.corr partial support
PNDSPY1239: pandas.core.window.expanding.Expanding.count partial support
PNDSPY1240: pandas.core.window.expanding.Expanding.max partial support
PNDSPY1241: pandas.core.window.expanding.Expanding.mean partial support
PNDSPY1242: pandas.core.window.expanding.Expanding.min partial support
PNDSPY1243: pandas.core.window.expanding.Expanding.sem partial support
PNDSPY1244: pandas.core.window.expanding.Expanding.std partial support
PNDSPY1245: pandas.core.window.expanding.Expanding.sum partial support
PNDSPY1246: pandas.core.window.expanding.Expanding.var partial support
PNDSPY1247: pandas.core.window.rolling.Rolling.corr partial support
PNDSPY1248: pandas.core.window.rolling.Rolling.count partial support
PNDSPY1249: pandas.core.window.rolling.Rolling.max partial support
PNDSPY1250: pandas.core.window.rolling.Rolling.mean partial support
PNDSPY1251: pandas.core.window.rolling.Rolling.min partial support
PNDSPY1252: pandas.core.window.rolling.Rolling.sem partial support
PNDSPY1253: pandas.core.window.rolling.Rolling.std partial support
PNDSPY1254: pandas.core.window.rolling.Rolling.sum partial support
PNDSPY1255: pandas.core.window.rolling.Rolling.var partial support
PNDSPY1256: pandas.core.window.rolling.Window.mean partial support
PNDSPY1257: pandas.core.window.rolling.Window.std partial support
PNDSPY1258: pandas.core.window.rolling.Window.sum partial support
PNDSPY1259: pandas.core.window.rolling.Window.var partial support
PNDSPY1260: pandas.io.json._json.read_json partial support
PNDSPY1261: pandas.io.parquet.read_parquet partial support
PNDSPY1262: pandas.io.parsers.readers.read_csv partial support
Changed¶
Updated the sfutils library implementation to support multiple levels of notebooks calls
Upgraded supported Snowpark Python version from
v1.41.0tov1.43.0. This upgrade includes the following mapping status changes: NotSupported → Direct (8 functions):pyspark.sql.functions.bool_and→snowflake.snowpark.functions.booland_aggpyspark.sql.functions.bucket→snowflake.snowpark.functions.bucketpyspark.sql.functions.cot→snowflake.snowpark.functions.cotpyspark.sql.functions.day→snowflake.snowpark.functions.daypyspark.sql.functions.every→snowflake.snowpark.functions.booland_aggpyspark.sql.functions.pi→snowflake.snowpark.functions.pipyspark.sql.functions.width_bucket→snowflake.snowpark.functions.width_bucketpyspark.sql.functions.zeroifnull→snowflake.snowpark.functions.zeroifnull
NotSupported → Rename (1 function):
pyspark.sql.functions.uuid→snowflake.snowpark.functions.uuid_stringUpgraded supported Snowpark Pandas version from
v1.41.0tov1.43.0.The mapping status of the following Pandas elements were updated: NotSupported → Direct (56 functions):
pandas.core.arrays.datetimes.DatetimeArray.datepandas.core.arrays.datetimes.DatetimeArray.normalizepandas.core.arrays.datetimes.DatetimeArray.timepandas.core.base.IndexOpsMixin.Tpandas.core.base.IndexOpsMixin.emptypandas.core.base.IndexOpsMixin.is_monotonic_decreasingpandas.core.base.IndexOpsMixin.is_monotonic_increasingpandas.core.base.IndexOpsMixin.is_uniquepandas.core.base.IndexOpsMixin.itempandas.core.base.IndexOpsMixin.ndimpandas.core.base.IndexOpsMixin.nuniquepandas.core.base.IndexOpsMixin.shapepandas.core.base.IndexOpsMixin.sizepandas.core.base.IndexOpsMixin.to_listpandas.core.base.IndexOpsMixin.to_numpypandas.core.base.IndexOpsMixin.tolistpandas.core.base.IndexOpsMixin.transposepandas.core.generic.NDFrame.abspandas.core.generic.NDFrame.add_prefixpandas.core.generic.NDFrame.add_suffixpandas.core.generic.NDFrame.attrspandas.core.generic.NDFrame.copypandas.core.generic.NDFrame.describepandas.core.generic.NDFrame.dtypespandas.core.generic.NDFrame.equalspandas.core.generic.NDFrame.firstpandas.core.generic.NDFrame.first_valid_indexpandas.core.generic.NDFrame.getpandas.core.generic.NDFrame.headpandas.core.generic.NDFrame.keyspandas.core.generic.NDFrame.lastpandas.core.generic.NDFrame.last_valid_indexpandas.core.generic.NDFrame.ndimpandas.core.generic.NDFrame.sizepandas.core.generic.NDFrame.squeezepandas.core.generic.NDFrame.tailpandas.core.generic.NDFrame.takepandas.core.generic.NDFrame.to_excelpandas.core.groupby.groupby.BaseGroupBy.groupspandas.core.groupby.groupby.GroupBy.countpandas.core.groupby.groupby.GroupBy.cumcountpandas.core.groupby.groupby.GroupBy.cummaxpandas.core.groupby.groupby.GroupBy.cumminpandas.core.groupby.groupby.GroupBy.cumsumpandas.core.groupby.groupby.GroupBy.headpandas.core.groupby.groupby.GroupBy.maxpandas.core.groupby.groupby.GroupBy.meanpandas.core.groupby.groupby.GroupBy.medianpandas.core.groupby.groupby.GroupBy.minpandas.core.groupby.groupby.GroupBy.rankpandas.core.groupby.groupby.GroupBy.sizepandas.core.groupby.groupby.GroupBy.tailpandas.core.indexes.datetimes.DatetimeIndex.yearpandas.core.indexing.IndexingMixin.iatpandas.core.indexing.IndexingMixin.ilocpandas.core.series.Series.first
NotSupported → Partial (70 functions):
pandas.core.arrays.datetimelike.DatelikeOps.strftime(PNDSPY1019)pandas.core.arrays.datetimelike.TimelikeOps.ceil(PNDSPY1020)pandas.core.arrays.datetimelike.TimelikeOps.floor(PNDSPY1021)pandas.core.arrays.datetimelike.TimelikeOps.round(PNDSPY1022)pandas.core.arrays.datetimes.DatetimeArray.day_name(PNDSPY1023)pandas.core.arrays.datetimes.DatetimeArray.month_name(PNDSPY1024)pandas.core.arrays.datetimes.DatetimeArray.tz_convert(PNDSPY1025)pandas.core.arrays.datetimes.DatetimeArray.tz_localize(PNDSPY1026)pandas.core.base.IndexOpsMixin.argmax(PNDSPY1027)pandas.core.base.IndexOpsMixin.argmin(PNDSPY1028)pandas.core.base.IndexOpsMixin.value_counts(PNDSPY1029)pandas.core.frame.DataFrame.eval(PNDSPY1049)pandas.core.frame.DataFrame.expanding(PNDSPY1050)pandas.core.frame.DataFrame.melt(PNDSPY1067)pandas.core.frame.DataFrame.pct_change(PNDSPY1077)pandas.core.frame.DataFrame.quantile(PNDSPY1081)pandas.core.frame.DataFrame.std(PNDSPY1103)pandas.core.generic.NDFrame.asfreq(PNDSPY1037)pandas.core.generic.NDFrame.fillna(PNDSPY1052)pandas.core.generic.NDFrame.mask(PNDSPY1066)pandas.core.generic.NDFrame.pct_change(PNDSPY1077)pandas.core.generic.NDFrame.rank(PNDSPY1083)pandas.core.generic.NDFrame.replace(PNDSPY1087)pandas.core.generic.NDFrame.shift(PNDSPY1115)pandas.core.generic.NDFrame.to_csv(PNDSPY1106)pandas.core.generic.NDFrame.tz_convert(PNDSPY1110)pandas.core.generic.NDFrame.tz_localize(PNDSPY1111)pandas.core.generic.NDFrame.where(PNDSPY1114)pandas.core.groupby.generic.DataFrameGroupBy.transform(PNDSPY1121)pandas.core.groupby.generic.DataFrameGroupBy.value_counts(PNDSPY1122)pandas.core.groupby.groupby.BaseGroupBy.get_group(PNDSPY1123)pandas.core.groupby.groupby.GroupBy.bfill(PNDSPY1127)pandas.core.groupby.groupby.GroupBy.first(PNDSPY1129)pandas.core.groupby.groupby.GroupBy.last(PNDSPY1130)pandas.core.groupby.groupby.GroupBy.quantile(PNDSPY1132)pandas.core.groupby.groupby.GroupBy.resample(PNDSPY1133)pandas.core.groupby.groupby.GroupBy.rolling(PNDSPY1134)pandas.core.groupby.groupby.GroupBy.shift(PNDSPY1135)pandas.core.groupby.groupby.GroupBy.std(PNDSPY1136)pandas.core.groupby.groupby.GroupBy.var(PNDSPY1137)pandas.core.indexes.base.Index.nlevels(PNDSPY1140)pandas.core.indexes.base.Index.sort_values(PNDSPY1142)pandas.core.indexing.IndexingMixin.at(PNDSPY1039)pandas.core.indexing.IndexingMixin.loc(PNDSPY1063)pandas.core.resample.Resampler.ffill(PNDSPY1155)pandas.core.resample.Resampler.first(PNDSPY1157)pandas.core.resample.Resampler.last(PNDSPY1158)pandas.core.resample.Resampler.std(PNDSPY1160)pandas.core.resample.Resampler.var(PNDSPY1161)pandas.core.reshape.merge.merge_asof(PNDSPY1165)pandas.core.reshape.pivot.pivot(PNDSPY1167)pandas.core.series.Series.expanding(PNDSPY1050)pandas.core.series.Series.pct_change(PNDSPY1077)pandas.core.window.ewm.ExponentialMovingWindow.corr(PNDSPY1233)pandas.core.window.ewm.ExponentialMovingWindow.mean(PNDSPY1234)pandas.core.window.ewm.ExponentialMovingWindow.std(PNDSPY1235)pandas.core.window.ewm.ExponentialMovingWindow.sum(PNDSPY1236)pandas.core.window.ewm.ExponentialMovingWindow.var(PNDSPY1237)pandas.core.window.expanding.Expanding.corr(PNDSPY1238)pandas.core.window.expanding.Expanding.max(PNDSPY1240)pandas.core.window.expanding.Expanding.mean(PNDSPY1241)pandas.core.window.expanding.Expanding.min(PNDSPY1242)pandas.core.window.expanding.Expanding.sem(PNDSPY1243)pandas.core.window.expanding.Expanding.std(PNDSPY1244)pandas.core.window.expanding.Expanding.sum(PNDSPY1245)pandas.core.window.expanding.Expanding.var(PNDSPY1246)pandas.core.window.rolling.Window.mean(PNDSPY1256)pandas.core.window.rolling.Window.std(PNDSPY1257)pandas.core.window.rolling.Window.sum(PNDSPY1258)pandas.core.window.rolling.Window.var(PNDSPY1259)
(new) → Direct (74 functions):
pandas.core.arrays.datetimes.DatetimeArray.daypandas.core.arrays.datetimes.DatetimeArray.day_of_weekpandas.core.arrays.datetimes.DatetimeArray.day_of_yearpandas.core.arrays.datetimes.DatetimeArray.dayofweekpandas.core.arrays.datetimes.DatetimeArray.dayofyearpandas.core.arrays.datetimes.DatetimeArray.days_in_monthpandas.core.arrays.datetimes.DatetimeArray.daysinmonthpandas.core.arrays.datetimes.DatetimeArray.hourpandas.core.arrays.datetimes.DatetimeArray.is_leap_yearpandas.core.arrays.datetimes.DatetimeArray.is_month_endpandas.core.arrays.datetimes.DatetimeArray.is_month_startpandas.core.arrays.datetimes.DatetimeArray.is_quarter_endpandas.core.arrays.datetimes.DatetimeArray.is_quarter_startpandas.core.arrays.datetimes.DatetimeArray.is_year_endpandas.core.arrays.datetimes.DatetimeArray.is_year_startpandas.core.arrays.datetimes.DatetimeArray.isocalendarpandas.core.arrays.datetimes.DatetimeArray.microsecondpandas.core.arrays.datetimes.DatetimeArray.minutepandas.core.arrays.datetimes.DatetimeArray.monthpandas.core.arrays.datetimes.DatetimeArray.nanosecondpandas.core.arrays.datetimes.DatetimeArray.quarterpandas.core.arrays.datetimes.DatetimeArray.secondpandas.core.arrays.datetimes.DatetimeArray.weekdaypandas.core.arrays.datetimes.DatetimeArray.yearpandas.core.arrays.timedeltas.TimedeltaArray.dayspandas.core.arrays.timedeltas.TimedeltaArray.microsecondspandas.core.arrays.timedeltas.TimedeltaArray.nanosecondspandas.core.arrays.timedeltas.TimedeltaArray.secondspandas.core.frame.DataFrame.flagspandas.core.generic.NDFrame.flagspandas.core.generic.NDFrame.rename_axispandas.core.groupby.groupby.BaseGroupBy.\_\_iter\_\_pandas.core.groupby.groupby.BaseGroupBy.\_\_len\_\_pandas.core.groupby.groupby.GroupBy.sumpandas.core.indexes.base.Index.Tpandas.core.indexes.datetimes.DatetimeIndex.datepandas.core.indexes.datetimes.DatetimeIndex.daypandas.core.indexes.datetimes.DatetimeIndex.day_of_weekpandas.core.indexes.datetimes.DatetimeIndex.day_of_yearpandas.core.indexes.datetimes.DatetimeIndex.dayofweekpandas.core.indexes.datetimes.DatetimeIndex.dayofyearpandas.core.indexes.datetimes.DatetimeIndex.hourpandas.core.indexes.datetimes.DatetimeIndex.is_month_endpandas.core.indexes.datetimes.DatetimeIndex.is_month_startpandas.core.indexes.datetimes.DatetimeIndex.meanpandas.core.indexes.datetimes.DatetimeIndex.microsecondpandas.core.indexes.datetimes.DatetimeIndex.minutepandas.core.indexes.datetimes.DatetimeIndex.monthpandas.core.indexes.datetimes.DatetimeIndex.nanosecondpandas.core.indexes.datetimes.DatetimeIndex.normalizepandas.core.indexes.datetimes.DatetimeIndex.quarterpandas.core.indexes.datetimes.DatetimeIndex.secondpandas.core.indexes.timedeltas.TimedeltaIndex.total_secondspandas.core.series.Series.info(PNDSPY1018)pandas.core.series.Series.tolistpandas.core.strings.accessor.StringMethods.capitalizepandas.core.strings.accessor.StringMethods.centerpandas.core.strings.accessor.StringMethods.countpandas.core.strings.accessor.StringMethods.islowerpandas.core.strings.accessor.StringMethods.istitlepandas.core.strings.accessor.StringMethods.isupperpandas.core.strings.accessor.StringMethods.ljustpandas.core.strings.accessor.StringMethods.lowerpandas.core.strings.accessor.StringMethods.matchpandas.core.strings.accessor.StringMethods.padpandas.core.strings.accessor.StringMethods.rjustpandas.core.strings.accessor.StringMethods.titlepandas.core.strings.accessor.StringMethods.uppersnowpark_pandas.read_snowflakesnowpark_pandas.to_dynamic_tablesnowpark_pandas.to_icebergsnowpark_pandas.to_pandassnowpark_pandas.to_snowflakesnowpark_pandas.to_view
(new) → Partial (47 functions):
pandas.core.frame.DataFrame.\_\_dataframe\_\_(PNDSPY1031)pandas.core.frame.DataFrame.pad(PNDSPY1076)pandas.core.generic.NDFrame.align(PNDSPY1033)pandas.core.generic.NDFrame.astype(PNDSPY1038)pandas.core.generic.NDFrame.expanding(PNDSPY1050)pandas.core.generic.NDFrame.ffill(PNDSPY1051)pandas.core.generic.NDFrame.interpolate(PNDSPY1015)pandas.core.generic.NDFrame.pad(PNDSPY1076)pandas.core.generic.NDFrame.resample(PNDSPY1088)pandas.core.generic.NDFrame.rolling(PNDSPY1092)pandas.core.generic.NDFrame.sample(PNDSPY1097)pandas.core.groupby.groupby.GroupBy.all(PNDSPY1124)pandas.core.groupby.groupby.GroupBy.any(PNDSPY1125)pandas.core.groupby.groupby.GroupBy.apply(PNDSPY1126)pandas.core.indexes.base.Index.all(PNDSPY1138)pandas.core.indexes.base.Index.any(PNDSPY1139)pandas.core.indexes.base.Index.reindex(PNDSPY1141)pandas.core.indexes.base.Index.value_counts(PNDSPY1029)pandas.core.indexes.datetimes.DatetimeIndex.tz_convert(PNDSPY1149)pandas.core.indexes.datetimes.DatetimeIndex.tz_localize(PNDSPY1150)pandas.core.series.Series.backfill(PNDSPY1040)pandas.core.series.Series.bfill(PNDSPY1041)pandas.core.series.Series.flags(PNDSPY1181)pandas.core.series.Series.pad(PNDSPY1076)pandas.core.strings.accessor.StringMethods.\_\_getitem\_\_(PNDSPY1216)pandas.core.strings.accessor.StringMethods.contains(PNDSPY1217)pandas.core.strings.accessor.StringMethods.endswith(PNDSPY1218)pandas.core.strings.accessor.StringMethods.get(PNDSPY1219)pandas.core.strings.accessor.StringMethods.isdigit(PNDSPY1220)pandas.core.strings.accessor.StringMethods.len(PNDSPY1221)pandas.core.strings.accessor.StringMethods.lstrip(PNDSPY1222)pandas.core.strings.accessor.StringMethods.replace(PNDSPY1223)pandas.core.strings.accessor.StringMethods.rstrip(PNDSPY1224)pandas.core.strings.accessor.StringMethods.slice(PNDSPY1225)pandas.core.strings.accessor.StringMethods.split(PNDSPY1226)pandas.core.strings.accessor.StringMethods.startswith(PNDSPY1227)pandas.core.strings.accessor.StringMethods.strip(PNDSPY1228)pandas.core.strings.accessor.StringMethods.translate(PNDSPY1229)pandas.core.window.rolling.Rolling.corr(PNDSPY1247)pandas.core.window.rolling.Rolling.max(PNDSPY1249)pandas.core.window.rolling.Rolling.mean(PNDSPY1250)pandas.core.window.rolling.Rolling.min(PNDSPY1251)pandas.core.window.rolling.Rolling.sem(PNDSPY1252)pandas.core.window.rolling.Rolling.std(PNDSPY1253)pandas.core.window.rolling.Rolling.sum(PNDSPY1254)pandas.core.window.rolling.Rolling.var(PNDSPY1255)pandas.io.json._json.read_json(PNDSPY1260)
Direct → Partial (12 functions):
pandas.core.frame.DataFrame.T(PNDSPY1030)pandas.core.frame.DataFrame.any(PNDSPY1035)pandas.core.frame.DataFrame.where(PNDSPY1114)pandas.core.groupby.generic.DataFrameGroupBy.agg(PNDSPY1116)pandas.core.indexes.datetimes.DatetimeIndex.round(PNDSPY1147)pandas.core.reshape.tile.qcut(PNDSPY1170)pandas.core.series.Series.astype(PNDSPY1038)pandas.core.series.Series.groupby(PNDSPY1184)pandas.core.series.Series.le(PNDSPY1186)pandas.core.series.Series.loc(PNDSPY1063)pandas.io.parquet.read_parquet(PNDSPY1261)pandas.io.parsers.readers.read_csv(PNDSPY1262)
Partial → Direct (5 functions):
pandas.core.indexes.datetimes.DatetimeIndex.is_leap_yearpandas.core.indexes.datetimes.DatetimeIndex.is_quarter_endpandas.core.indexes.datetimes.DatetimeIndex.is_quarter_startpandas.core.indexes.datetimes.DatetimeIndex.is_year_endpandas.core.indexes.datetimes.DatetimeIndex.is_year_start
Rename → Partial (4 functions):
pandas.core.frame.DataFrame.divide(PNDSPY1046)pandas.core.frame.DataFrame.multiply(PNDSPY1071)pandas.core.frame.DataFrame.subtract(PNDSPY1105)pandas.core.series.Series.divide(PNDSPY1178)
Fixed¶
Fixed the “How to read through the scores” link on the assessment and conversion results page to ensure it correctly opens the readiness score documentation.
Version 3.0.0 (Feb 12, 2026)¶
Application & CLI Version: 3.0.0¶
Included SMA Core Version¶
Snowpark Conversion Core: 8.1.55
Engine Release Notes¶
Improvements¶
License-Free Conversion Mode: A license or access code is no longer required to run SMA in Conversion mode.
Project Options Page: A new Project Options page has been introduced to present the available workflows in the application, including “Code Analysis and Conversion”.
Technical Discovery Relocation: The Technical Discovery section has been moved to the Project Creation page for a more streamlined project setup experience.
Simplified Conversion Setup: The Conversion Setup page has been updated and no longer requires a license or access code.
Project File Extension: The project file extension has changed from
.snowmato.snowct.Updated User Interface: The user interface has been refreshed to align with the SnowConvert AI look and feel.
Version 2.11.1 (Jan 30, 2026)¶
Application & CLI Version: 2.11.1¶
Included SMA Core Version¶
Snowpark Conversion Core: 8.1.55
Engine Release Notes¶
Added¶
Added SQL Language to the DetailedReport doc file.
Added SQL configuration cell at the beginning of a converted Databricks-to-Jupyter transformation to be compatible with Snowflake notebooks.
Changed¶
Updated the
%runmagic command transformation to append.ipynbextension to notebook paths.For unquoted paths:
%run ./myNotebooktransforms to%run ./myNotebook.ipynbFor quoted paths:
%run "./myNotebook"transforms to%run "./myNotebook.ipynb"
Scala code in notebook cells will now be commented in a python cell during a notebook migration.
Updated the conversion of
dbutils.runto thesfutils.notebook.runfunction to handle notebook execution calls.Bumped the supported versions of Snowpark Python API and Snowpark Pandas API from
1.40.0to1.41.0.Updated the mapping status for the following Pandas functions from NotSupported to Partial:
pandas.core.frame.DataFrame.agg→modin.pandas.DataFrame.aggpandas.core.frame.DataFrame.interpolate→modin.pandas.DataFrame.interpolatepandas.core.reshape.encoding.get_dummies→modin.pandas.general.get_dummiespandas.core.series.Series.agg→modin.pandas.Series.aggpandas.core.series.Series.interpolate→modin.pandas.Series.interpolate
Fixed¶
SMA now will rename
.hql(Hive SQL) files to.sqlafter conversion.The implicit cell for a DBX Scala Notebook when converting to Snowflake will be a python cell with an EWI. The Scala code will be commented out.
Python cells from DBX SQL Notebooks will preserve the language metadata.
Removed¶
Removed the previous
%runtransformation in DBX notebooks that generatedspark.sql("EXECUTE NOTEBOOK ...")SQL statements.The SnowConvert MissingObjects report was absorbed by the MissingObjectReference report. The MissingObjects report will no longer be generated.
Version 2.11.0 (Jan 9, 2026)¶
Application & CLI Version: 2.11.0¶
Included SMA Core Version¶
Snowpark Conversion Core: 8.1.43
Included SnowConvert AI Version¶
SnowConvert AI Version 2.2.0 (Release Notes)
Engine Release Notes¶
Added¶
Enhanced Notebook Setup for Assessment: When running an assessment on Databricks notebooks, a Snowpark Connect session is now automatically added to the first cell to simplify your setup.
Automatic Snowpark Connect Conversion: The tool now automatically converts both
SparkSessionandSparkContextinitializations in Python code to their equivalent Snowpark Connect sessions.Improved Error Identification:
Added a new warning code,
SPRKCNTPY4000, to clearly flag anySparkContextelements that are not yet supported by Snowpark Connect.The tool now automatically detects and flags unsupported Databricks utility calls (
dbutilsAPI) with the new warning codeSPRKDBX1004during conversion.
More Detailed Reporting:
The SparkUsagesInventory.csv report now includes a new column called
IS_SNOWPARK_CONNECT_TOOL_SUPPORTEDThis new column is to clearly indicate if a Spark element is supported directly by Snowpark Connect, or supported throught an SMA transformation.
The Snowpark Connect readiness score calculation has been updated to use the new
IS_SNOWPARK_CONNECT_TOOL_SUPPORTEDcolumn in the SparkUsagesInventory.csv report.
Next-Generation Notebook Support: Enhanced support for the VNext Snowflake Notebooks format when converting Databricks or Jupyter notebooks.
Full VNext Compatibility: The SMA can now generate output files that fully adhere to the VNext Snowflake Notebooks standard, regardless of whether the source was a Databricks or a previous-generation Jupyter notebook.
Smarter Language Handling: The conversion engine has been updated with enhanced logic to accurately detect and manage the specific language (such as Python or Scala) within each individual notebook cell. This allows for more precise and reliable cell-by-cell conversion.
Enhanced Metadata for Cells: The process now correctly incorporates necessary language and type metadata at the cell level during generation, which is essential for VNext Notebooks to function as expected.
Changed¶
Simplified Python Code: For Snowpark Connect, unnecessary
.sparkContextreferences in Python method calls are now removed to streamline your code.Clearer Warning Codes: Snowpark Connect warning codes are now renamed to include language-specific prefixes (e.g.,
SPRKCNTPYfor Python,SPRKCNTSCLfor Scala) for easier error identification.More Accurate Notebook Conversions: The conversion process for notebooks has been improved to correctly distinguish between Databricks and Jupyter formats, preventing incorrect modifications.
Fixed¶
Fixed a bug in the artifact dependency inventory that incorrectly reported
.options()configuration as a data source.
Desktop Release Notes¶
Added¶
Technical Discovery View: A new Technical Discovery View is now available in the desktop application.
SMA Assessment AI: SMA desktop application is now directly integrated with an optional LLM interface.
Ask questions about your assessment results
Get help with how to approach the migration
Connect and deploy your assessment results directly into your Snowflake account.
Changed¶
The Command Line Interface (CLI) parameter for controlling Jupyter conversion has been updated from
--enableJupyterto--disableJupyterConversionfor clearer functionality.
Version 2.10.5 (Dec 3rd, 2025)¶
Application & CLI Version: 2.10.5¶
Included SMA Core Versions¶
Snowpark Conversion Core: 8.1.26
Included SnowConvert AI Version¶
SnowConvert AI Version 2.0.57 (Release Notes: SnowConvert AI - Recent Release Notes | Snowflake Documentation)
Engine Release Notes¶
Added¶
The Execution Summary section of the
DetailedReport.docxnow indicates whether the SMA was run in Assessment or Conversion mode.
Changed¶
Bumped the supported versions of Snowpark Python API and Snowpark Pandas API from
1.39.0to1.40.0.
PySpark Function Mapping Updates:
NotSupported to Rename:
pyspark.sql.functions.unhex→snowflake.snowpark.functions.hex_decode_binary
Direct to Rename:
pyspark.sql.functions.greatest→snowflake.snowpark.functions.greatest_ignore_nullspyspark.sql.functions.least→snowflake.snowpark.functions.least_ignore_nulls
NotDefined to Rename:
pyspark.sql.functions.bool_or→snowflake.snowpark.functions.boolor_aggpyspark.sql.functions.char→snowflake.snowpark.functions.chr
NotDefined to Direct:
pyspark.sql.functions.nullif→snowflake.snowpark.functions.nullifpyspark.sql.functions.nvl2→snowflake.snowpark.functions.nvl2
Snowpark Pandas Function Mapping Updates:
NotSupported to Partial:
modin.pandas.DataFrame.query→snowflake.snowpark.pandas.core.frame.DataFrame.queryAdded a new EWI
PNDSPY1012to indicate thatmodin.pandas.DataFrame.querydoes not support MultiIndex. The following example scenario illustrating this limitation is also included in the EWI documentation.from snowflake.snowpark.modin import plugin import modin.pandas as pd # Snowpark pandas # Create a DataFrame with single-level index data = { 'name': ['Alice', 'Bob', 'Charlie', 'David', 'Eve', 'Frank'], 'age': [25, 30, 35, 28, 32, 45], 'salary': [50000, 60000, 75000, 55000, 80000, 90000], 'department': ['Sales', 'IT', 'HR', 'Sales', 'IT', 'HR'] } df = pd.DataFrame(data) # Set a single-level index df = df.set_index('name') print("DataFrame with single-level index:") print(df) # Use query() - This works fine! #EWI: PNDSPY1012 => pandas.core.frame.DataFrame.query does not support DataFrames that have a row MultiIndex. Check Snowpark Pandas documentation for more details. result = df.query("age > 30 and salary < 85000") # Create a DataFrame with MultiIndex on rows data = { 'A': [1, 2, 3, 4, 5, 6], 'B': [10, 20, 30, 40, 50, 60], 'C': ['x', 'y', 'x', 'y', 'x', 'y'] } df = pd.DataFrame(data) # Create MultiIndex df = df.set_index([ pd.Index(['group1', 'group1', 'group2', 'group2', 'group3', 'group3']), pd.Index(['a', 'b', 'a', 'b', 'a', 'b']) ]) df.index.names = ['group', 'subgroup'] # This will ERROR in Snowpark pandas! #EWI: PNDSPY1012 => pandas.core.frame.DataFrame.query does not support DataFrames that have
Recommended fix: If the DataFrame contains a MultiIndex, it is necessary to validate the behavior of the
query()method in Snowpark pandas. Ensure that the DataFrame structure is compatible with Snowpark pandas’ limitations, as MultiIndex rows are not supported. Consider restructuring the DataFrame to use a single-level index or alternative filtering methods.Updated all documentation links in the
DetailedReport.docxto point to the official Snowflake documentation, replacing the legacy Snowpark Migration Accelerator site.Updated the Snowpark Connect readiness score descriptions in the
DetailedReport.docxto match the SMA UI.Usages of
pyspark.sql.window.WindowSpec.orderByare now reported as supported by Snowpark Connect.
Fixed¶
Fixed broken internal links in the
DetailedReport.docxto ensure proper navigation between document sections.Added a
CellIdcolumn to the issues inventory to easily identify the location of EWIs within notebook files.
Version 2.10.4 (Nov 18, 2025)¶
Application & CLI Version: 2.10.4¶
Included SMA Core Versions¶
Snowpark Conversion Core: 8.1.8
Engine Release Notes¶
Fixed¶
Fixed an issue where the SMA generated corrupted Databricks notebook files in the output directory during Assessment mode execution.
Fixed an issue where the SMA would crash if the input directory contained folders named “SMA_ConvertedNotebooks”.
Version 2.10.3 (Oct 30, 2025)¶
Application & CLI Version: 2.10.3¶
Included SMA Core Versions¶
Snowpark Conversion Core: 8.1.7
Engine Release Notes¶
Added¶
Added the Snowpark Connect readiness score. This new score measures the percentage of Spark API references in your codebase that are supported by Snowpark Connect for Spark.
This will now be the only score shown in assessment mode. To generate the Snowpark API Readiness Score, run the SMA in conversion mode.
Added support for SQL embedded migration for literal string concatenations assigned to a local variable in the same scope of execution.
Included scenarios now include:
sqlStat = "SELECT colName " + "FROM myTable" session.sql(sqlStat)
Changed¶
Updated the EWI URLs in the Issues.csv inventory to point to the main Snowflake documentation site.
Fixed¶
Fixed a code issue that caused inner project configuration files (e.g., pom.xml, build.sbt, build.gradle) to be incorrectly placed in the root of the output directory instead of the correct inner directories after migration.
Desktop Release Notes¶
Added¶
Added the Snowpark Connect readiness score and updated the assessment execution flow.
When running the application in assessment mode, only the Snowpark Connect readiness score is now displayed.
When running the application in conversion mode, the Snowpark API readiness score is displayed (the Snowpark Connect Readiness will not be shown).
Changed¶
Updated all in-application documentation links to point to the official Snowflake documentation, replacing the legacy SnowConvert site.
Version 2.10.2 (Oct 27, 2025)¶
Application & CLI Version 2.10.2¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.73
Fixed¶
Fixed an issue where the Snowpark Migration Accelerator failed converting DBC files into Jupyter Notebooks properly.
Version 2.10.1 (Oct 23, 2025)¶
Application & CLI Version 2.10.1¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.72
Added¶
Added support for Snowpark Scala v1.17.0:
From Not Supported to Direct:
Dataset:
org.apache.spark.sql.Dataset.isEmpty→com.snowflake.snowpark.DataFrame.isEmpty
Row:
org.apache.spark.sql.Row.mkString→com.snowflake.snowpark.Row.mkString
StructType:
org.apache.spark.sql.types.StructType.fieldNames→com.snowflake.snowpark.types.StructType.fieldNames
From Not Supported to Rename:
Functions:
org.apache.spark.functions.flatten→com.snowflake.snowpark.functions.array_flatten
From Direct to Rename:
Functions:
org.apache.spark.functions.to_date→com.snowflake.snowpark.functions.try_to_dateorg.apache.spark.functions.to_timestamp→com.snowflake.snowpark.functions.try_to_timestamp
From Direct Helper to Rename:
Functions:
org.apache.spark.sql.functions.concat_ws→com.snowflake.snowpark.functions.concat_ws_ignore_nulls
From Not Defined to Direct:
Functions:
org.apache.spark.functions.try_to_timestamp→com.snowflake.snowpark.functions.try_to_timestampEmbedded SQL is now migrated when a SQL statement literal is assigned to a local variable.
Example: sqlStat = “SELECT colName FROM myTable” session.sql(sqlStat)
Embedded SQL is now supported for literal strings concatenations.
Example: session.sql(“SELECT colName “ + “FROM myTable”)
Changed¶
Updated the supported versions of Snowpark Python API and Snowpark Pandas API from 1.36.0 to 1.39.0.
Updated the mapping status for the following PySpark xpath functions from NotSupported to Direct with EWI SPRKPY1103:
pyspark.sql.functions.xpathpyspark.sql.functions.xpath_booleanpyspark.sql.functions.xpath_doublepyspark.sql.functions.xpath_floatpyspark.sql.functions.xpath_intpyspark.sql.functions.xpath_longpyspark.sql.functions.xpath_numberpyspark.sql.functions.xpath_shortpyspark.sql.functions.xpath_string
Updated the mapping status for the following PySpark elements from NotDefined to Direct:
pyspark.sql.functions.bit_and→snowflake.snowpark.functions.bitand_aggpyspark.sql.functions.bit_or→snowflake.snowpark.functions.bitor_aggpyspark.sql.functions.bit_xor→snowflake.snowpark.functions.bitxor_aggpyspark.sql.functions.getbit→snowflake.snowpark.functions.getbit
Updated the mapping status for the following Pandas elements from NotSupported to Direct:
pandas.core.indexes.base.Index→modin.pandas.Indexpandas.core.indexes.base.Index.get_level_values→modin.pandas.Index.get_level_values
Updated the mapping status for the following PySpark functions from NotSupported to Rename:
pyspark.sql.functions.now→snowflake.snowpark.functions.current_timestamp
Fixed¶
Fixed Scala not migrating imports when there’s a rename.
Example:
Source code:
.. code-block:: scala
package com.example.functions
import org.apache.spark.sql.functions.{to_timestamp, lit}
object ToTimeStampTest extends App { to_timestamp(lit(“sample”)) to_timestamp(lit(“sample”), “yyyy-MM-dd”) }Output code:
.. code-block:: scala
package com.example.functions
import com.snowflake.snowpark.functions.{try_to_timestamp, lit} import com.snowflake.snowpark_extensions.Extensions._ import com.snowflake.snowpark_extensions.Extensions.functions._
object ToTimeStampTest extends App { try_to_timestamp(lit(“sample”)) try_to_timestamp(lit(“sample”), “yyyy-MM-dd”) }
Version 2.10.0 (Sep 24, 2025)¶
Application & CLI Version 2.10.0¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.62
Added¶
Added functionality to migrate SQL embedded with Python format interpolation.
Added support for
DataFrame.selectandDataFrame.sorttransformations for greater data processing flexibility.
Changed¶
Bumped the supported versions of Snowpark Python API and Snowpark Pandas API to 1.36.0.
Updated the mapping status of
pandas.core.frame.DataFrame.boxplotfrom Not Supported to Direct.Updated the mapping status of
DataFrame.select,Dataset.select,DataFrame.sortandDataset.sortfrom Direct to Transformation.Snowpark Scala allows a sequence of columns to be passed directly to the select and sort functions, so this transformation changes all the usages such as
df.select(cols: _*)todf.select(cols)anddf.sort(cols: _*)todf.sort(cols).Bumped Python AST and Parser version to 149.1.9.
Updated the status to Direct for pandas functions:
pandas.core.frame.DataFrame.to_excelpandas.core.series.Series.to_excelpandas.io.feather_format.read_featherpandas.io.orc.read_orcpandas.io.stata.read_stata
Updated the status for
pyspark.sql.pandas.map_ops.PandasMapOpsMixin.mapInPandasto workaround using the EWI SPRKPY1102.
Fixed¶
Fixed issue that affected SqlEmbedded transformations when using chained method calls.
Fixed transformations involving PySqlExpr using the new PyLiteralSql to avoid losing Tails.
Resolved internal stability issues to improve tool robustness and reliability.
Version 2.7.7 (Aug 28, 2025)¶
Application & CLI Version 2.7.7¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.46
Added¶
Added new Pandas EWI documentation PNDSPY1011.
Added support to the following Pandas functions:
pandas.core.algorithms.unique
pandas.core.dtypes.missing.isna
pandas.core.dtypes.missing.isnull
pandas.core.dtypes.missing.notna
pandas.core.dtypes.missing.notnull
pandas.core.resample.Resampler.count
pandas.core.resample.Resampler.max
pandas.core.resample.Resampler.mean
pandas.core.resample.Resampler.median
pandas.core.resample.Resampler.min
pandas.core.resample.Resampler.size
pandas.core.resample.Resampler.sum
pandas.core.arrays.timedeltas.TimedeltaArray.total_seconds
pandas.core.series.Series.get
pandas.core.series.Series.to_frame
pandas.core.frame.DataFrame.assign
pandas.core.frame.DataFrame.get
pandas.core.frame.DataFrame.to_numpy
pandas.core.indexes.base.Index.is_unique
pandas.core.indexes.base.Index.has_duplicates
pandas.core.indexes.base.Index.shape
pandas.core.indexes.base.Index.array
pandas.core.indexes.base.Index.str
pandas.core.indexes.base.Index.equals
pandas.core.indexes.base.Index.identical
pandas.core.indexes.base.Index.unique
Added support to the following Spark Scala functions:
org.apache.spark.sql.functions.format_number
org.apache.spark.sql.functions.from_unixtime
org.apache.spark.sql.functions.instr
org.apache.spark.sql.functions.months_between
org.apache.spark.sql.functions.pow
org.apache.spark.sql.functions.to_unix_timestamp
org.apache.spark.sql.Row.getAs
Changed¶
Bumped the version of Snowpark Pandas API supported by the SMA to 1.33.0.
Bumped the version of Snowpark Scala API supported by the SMA to 1.16.0.
Updated the mapping status of pyspark.sql.group.GroupedData.pivot from Transformation to Direct.
Updated the mapping status of org.apache.spark.sql.Builder.master from NotSupported to Transformation. This transformation removes all the identified usages of this element during code conversion.
Updated the mapping status of org.apache.spark.sql.types.StructType.fieldIndex from NotSupported to Direct.
Updated the mapping status of org.apache.spark.sql.Row.fieldIndex from NotSupported to Direct.
Updated the mapping status of org.apache.spark.sql.SparkSession.stop from NotSupported to Rename. All the identified usages of this element are renamed to com.snowflake.snowpark.Session.close during code conversion.
Updated the mapping status of org.apache.spark.sql.DataFrame.unpersist and org.apache.spark.sql.Dataset.unpersist from NotSupported to Transformation. This transformation removes all the identified usages of this element during code conversion.
Fixed¶
Fixed continuation backslash on removed tailed functions.
Fix the LIBRARY_PREFIX column in the ConversionStatusLibraries.csv file to use the right identifier for scikit-learn library family (scikit-*).
Fixed bug not parsing multiline grouped operations.
Version 2.9.0 (Sep 09, 2025)¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.53
Added¶
The following mappings are now performed for
org.apache.spark.sql.Dataset[T]:org.apache.spark.sql.Dataset.unionis nowcom.snowflake.snowpark.DataFrame.unionAllorg.apache.spark.sql.Dataset.unionByNameis nowcom.snowflake.snowpark.DataFrame.unionAllByName
Added support for
org.apache.spark.sql.functions.broadcastas a transformation.
Changed¶
Increased the supported Snowpark Python API version for SMA from
1.27.0to1.33.0.The status for the
pyspark.sql.function.randnfunction has been updated to Direct.
Fixed¶
Resolved an issue where
org.apache.spark.SparkContext.parallelizewas not resolving and now supports it as a transformation.Fixed the
Dataset.persisttransformation to work with any type of Dataset, not justDataset[Row].
Version 2.7.6 (Jul 17, 2025)¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.30
Added¶
Adjusted mappings for spark.DataReader methods.
DataFrame.unionis nowDataFrame.unionAll.DataFrame.unionByNameis nowDataFrame.unionAllByName.Added multi-level artifact dependency columns in artifact inventory
Added new Pandas EWIs documentation, from
PNDSPY1005toPNDSPY1010.Added a specific EWI for
pandas.core.series.Series.apply.
Changed¶
Bumped the version of Snowpark Pandas API supported by the SMA from
1.27.0to1.30.0.
Fixed¶
Fixed an issue with missing values in the formula to get the SQL readiness score.
Fixed a bug that was causing some Pandas elements to have the default EWI message from PySpark.
Version 2.7.5 (Jul 2, 2025)¶
Application & CLI Version 2.7.5¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.19
Changed¶
Refactored Pandas Imports: Pandas imports now use `modin.pandas` instead of
snowflake.snowpark.modin.pandas.Improved `dbutils` and Magic Commands Transformation:
A new
sfutils.pyfile is now generated, and alldbutilsprefixes are replaced withsfutils.For Databricks (DBX) notebooks, an implicit import for
sfutilsis automatically added.The
sfutilsmodule simulates variousdbutilsmethods, including file system operations (dbutils.fs) via a defined Snowflake FileSystem (SFFS) stage, and handles notebook execution (dbutils.notebook.run) by transforming it toEXECUTE NOTEBOOKSQL functions.dbutils.notebook.exitis removed as it is not required in Snowflake.
Fixed¶
Updates in SnowConvert Reports: SnowConvert reports now include the CellId column when instances originate from SMA, and the FileName column displays the full path.
Updated Artifacts Dependency for SnowConvert Reports: The SMA’s artifact inventory report, which was previously impacted by the integration of SnowConvert, has been restored. This update enables the SMA tool to accurately capture and analyze Object References and Missing Object References directly from SnowConvert reports, thereby ensuring the correct retrieval of SQL dependencies for the inventory.
Version 2.7.4 (Jun 26, 2025)¶
Application & CLI Version 2.7.4¶
Desktop App
Added¶
Added telemetry improvements.
Fixed¶
Fix documentation links in conversion settings pop-up and Pandas EWIs.
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.16
Added¶
Transforming Spark XML to Snowpark
Databricks SQL option in the SQL source language
Transform JDBC read connections.
Changed¶
All the SnowConvert reports are copied to the backup Zip file.
The folder is renamed from
SqlReportstoSnowConvertReports.SqlFunctionsInventoryis moved to the folderReports.All the SnowConvert Reports are sent to Telemetry.
Fixed¶
Non-deterministic issue with SQL Readiness Score.
Fixed a false-positive critical result that made the desktop crash.
Fixed issue causing the Artifacts dependency report not to show the SQL objects.
Version 2.7.2 (Jun 10, 2025)¶
Application & CLI Version 2.7.2¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.2
Fixed¶
Addressed an issue with SMA execution on the latest Windows OS, as previously reported. This fix resolves the issues encountered in version 2.7.1.
Version 2.7.1 (Jun 9, 2025)¶
Application & CLI Version 2.7.1¶
Included SMA Core Versions¶
Snowpark Conversion Core 8.0.1
Added¶
The Snowpark Migration Accelerator (SMA) now orchestrates SnowConvert to process SQL found in user workloads, including embedded SQL in Python / Scala code, Notebook SQL cells, .sql files, and .hql files.
The SnowConvert now enhances the previous SMA capabilities:
A new folder in the Reports called SQL Reports contains the reports generated by SnowConvert.
Known Issues¶
The previous SMA version for SQL reports will appear empty for the following:
For
Reports/SqlElementsInventory.csv, partially covered by theReports/SqlReports/Elements.yyyymmdd.hhmmss.csv.For
Reports/SqlFunctionsInventory.csvrefer to the new location with the same name atReports/SqlReports/SqlFunctionsInventory.csv
The artifact dependency inventory:
In the
ArtifactDependencyInventorythe column for the SQL Object will appear empty
Version 2.6.10 (May 5, 2025)¶
Application & CLI Version 2.6.10¶
Included SMA Core Versions¶
Snowpark Conversion Core 7.4.0
Fixed¶
Fixed wrong values in the ‘checkpoints.json’ file.
The ‘sample’ value was without decimals (for integer values) and quotes.
The ‘entryPoint’ value had dots instead of slashes and was missing the file extension.
Updated the default value to TRUE for the setting ‘Convert DBX notebooks to Snowflake notebooks’
Version 2.6.8 (Apr 28, 2025)¶
Application & CLI Version 2.6.8¶
Desktop App¶
Added checkpoints execution settings mechanism recognition.
Added a mechanism to collect DBX magic commands into DbxElementsInventory.csv
Added ‘checkpoints.json’ generation into the input directory.
Added a new EWI for all not supported magic command.
Added the collection of dbutils into DbxElementsInventory.csv from scala source notebooks
Included SMA Core Versions¶
Snowpark Conversion Core 7.2.53
Changed¶
Updates made to handle transformations from DBX Scala elements to Jupyter Python elements, and to comment the entire code from the cell.
Updates made to handle transformations from dbutils.notebook.run and “r” commands, for the last one, also comment out the entire code from the cell.
Updated the name and the letter of the key to make the conversion of the notebook files.
Fixed¶
Fixed the bug that was causing the transformation of DBX notebooks into .ipynb files to have the wrong format.
Fixed the bug that was causing .py DBX notebooks to not be transformable into .ipynb files.
Fixed a bug that was causing comments to be missing in the output code of DBX notebooks.
Fixed a bug that was causing raw Scala files to be converted into ipynb files.
Version 2.6.7 (Apr 21, 2025)¶
Application & CLI Version 2.6.7¶
Included SMA Core Versions¶
Snowpark Conversion Core 7.2.42
Changed¶
Updated DataFramesInventory to fill EntryPoints column
Version 2.6.6 (Apr 7, 2025)¶
Application & CLI Version 2.6.6¶
Desktop App¶
Added¶
Update DBx EWI link in the UI results page
Included SMA Core Versions¶
Snowpark Conversion Core 7.2.39
Added¶
Added Execution Flow inventory generation.
Added implicit session setup in every DBx notebook transformation
Changed¶
Renamed the DbUtilsUsagesInventory.csv to DbxElementsInventory.csv
Fixed¶
Fixed a bug that caused a Parsing error when a backslash came after a type hint.
Fixed relative imports that do not start with a dot and relative imports with a star.
Version 2.6.5 (Mar 27, 2025)¶
Application & CLI Version 2.6.5¶
Desktop App¶
Added¶
Added a new conversion setting toggle to enable or disable Sma-Checkpoints feature.
Fix report issue to not crash when post api returns 500
Included SMA Core Versions¶
Snowpark Conversion Core 7.2.26
Added¶
Added generation of the checkpoints.json file into the output folder based on the DataFramesInventory.csv.
Added “disableCheckpoints” flag into the CLI commands and additional parameters of the code processor.
Added a new replacer for Python to transform the dbutils.notebook.run node.
Added new replacers to transform the magic %run command.
Added new replacers (Python and Scala) to remove the dbutils.notebook.exit node.
Added Location column to artifacts inventory.
Changed¶
Refactored the normalized directory separator used in some parts of the solution.
Centralized the DBC extraction working folder name handling.
Updated Snowpark and Pandas version to v1.27.0
Updated the artifacts inventory columns to:
Name -> Dependency
File -> FileId
Status -> Status_detail
Added new column to the artifacts inventory:
Success
Fixed¶
Dataframes inventory was not being uploaded to the stage correctly.
Version 2.6.4 (Mar 12, 2025)¶
Application & CLI Version 2.6.4¶
Included SMA Core Versions ¶
Snowpark Conversion Core 7.2.0
Added ¶
An Artifact Dependency Inventory
A replacer and EWI for pyspark.sql.types.StructType.fieldNames method to snowflake.snowpark.types.StructType.fieldNames attribute.
The following PySpark functions with the status:
Direct Status
pyspark.sql.functions.bitmap_bit_positionpyspark.sql.functions.bitmap_bucket_numberpyspark.sql.functions.bitmap_construct_aggpyspark.sql.functions.equal_nullpyspark.sql.functions.ifnullpyspark.sql.functions.localtimestamppyspark.sql.functions.max_bypyspark.sql.functions.min_bypyspark.sql.functions.nvlpyspark.sql.functions.regr_avgxpyspark.sql.functions.regr_avgypyspark.sql.functions.regr_countpyspark.sql.functions.regr_interceptpyspark.sql.functions.regr_slopepyspark.sql.functions.regr_sxxpyspark.sql.functions.regr_sxypyspark.sql.functions.regr
NotSupported
pyspark.sql.functions.map_contains_keypyspark.sql.functions.positionpyspark.sql.functions.regr_r2pyspark.sql.functions.try_to_binary
The following Pandas functions with status
pandas.core.series.Series.str.ljustpandas.core.series.Series.str.centerpandas.core.series.Series.str.padpandas.core.series.Series.str.rjust
Update the following Pyspark functions with the status
From WorkAround to Direct
pyspark.sql.functions.acoshpyspark.sql.functions.asinhpyspark.sql.functions.atanhpyspark.sql.functions.instrpyspark.sql.functions.log10pyspark.sql.functions.log1ppyspark.sql.functions.log2
From NotSupported to Direct
pyspark.sql.functions.bit_lengthpyspark.sql.functions.cbrtpyspark.sql.functions.nth_valuepyspark.sql.functions.octet_lengthpyspark.sql.functions.base64pyspark.sql.functions.unbase64
Updated the folloing Pandas functions with the status
From NotSupported to Direct
pandas.core.frame.DataFrame.poppandas.core.series.Series.betweenpandas.core.series.Series.pop
Version 2.6.3 (Mar 6, 2025)¶
Application & CLI Version 2.6.3¶
Included SMA Core Versions ¶
Snowpark Conversion Core 7.1.13
Added ¶
Added csv generator class for new inventory creation.
Added “full_name” column to import usages inventory.
Added transformation from pyspark.sql.functions.concat_ws to snowflake.snowpark.functions._concat_ws_ignore_nulls.
Added logic for generation of checkpoints.json.
Added the inventories:
DataFramesInventory.csv.
CheckpointsInventory.csv
Version 2.6.0 (Feb 21, 2025)¶
Application & CLI Version 2.6.0¶
Desktop App ¶
Updated the licensing agreement, acceptance is required.
Included SMA Core Versions¶
Snowpark Conversion Core 7.1.2
Added
Updated the mapping status for the following PySpark elements, from NotSupported to Direct
pyspark.sql.types.ArrayType.jsonpyspark.sql.types.ArrayType.jsonValuepyspark.sql.types.ArrayType.simpleStringpyspark.sql.types.ArrayType.typeNamepyspark.sql.types.AtomicType.jsonpyspark.sql.types.AtomicType.jsonValuepyspark.sql.types.AtomicType.simpleStringpyspark.sql.types.AtomicType.typeNamepyspark.sql.types.BinaryType.jsonpyspark.sql.types.BinaryType.jsonValuepyspark.sql.types.BinaryType.simpleStringpyspark.sql.types.BinaryType.typeNamepyspark.sql.types.BooleanType.jsonpyspark.sql.types.BooleanType.jsonValuepyspark.sql.types.BooleanType.simpleStringpyspark.sql.types.BooleanType.typeNamepyspark.sql.types.ByteType.jsonpyspark.sql.types.ByteType.jsonValuepyspark.sql.types.ByteType.simpleStringpyspark.sql.types.ByteType.typeNamepyspark.sql.types.DecimalType.jsonpyspark.sql.types.DecimalType.jsonValuepyspark.sql.types.DecimalType.simpleStringpyspark.sql.types.DecimalType.typeNamepyspark.sql.types.DoubleType.jsonpyspark.sql.types.DoubleType.jsonValuepyspark.sql.types.DoubleType.simpleStringpyspark.sql.types.DoubleType.typeNamepyspark.sql.types.FloatType.jsonpyspark.sql.types.FloatType.jsonValuepyspark.sql.types.FloatType.simpleStringpyspark.sql.types.FloatType.typeNamepyspark.sql.types.FractionalType.jsonpyspark.sql.types.FractionalType.jsonValuepyspark.sql.types.FractionalType.simpleStringpyspark.sql.types.FractionalType.typeNamepyspark.sql.types.IntegerType.jsonpyspark.sql.types.IntegerType.jsonValuepyspark.sql.types.IntegerType.simpleStringpyspark.sql.types.IntegerType.typeNamepyspark.sql.types.IntegralType.jsonpyspark.sql.types.IntegralType.jsonValuepyspark.sql.types.IntegralType.simpleStringpyspark.sql.types.IntegralType.typeNamepyspark.sql.types.LongType.jsonpyspark.sql.types.LongType.jsonValuepyspark.sql.types.LongType.simpleStringpyspark.sql.types.LongType.typeNamepyspark.sql.types.MapType.jsonpyspark.sql.types.MapType.jsonValuepyspark.sql.types.MapType.simpleStringpyspark.sql.types.MapType.typeNamepyspark.sql.types.NullType.jsonpyspark.sql.types.NullType.jsonValuepyspark.sql.types.NullType.simpleStringpyspark.sql.types.NullType.typeNamepyspark.sql.types.NumericType.jsonpyspark.sql.types.NumericType.jsonValuepyspark.sql.types.NumericType.simpleStringpyspark.sql.types.NumericType.typeNamepyspark.sql.types.ShortType.jsonpyspark.sql.types.ShortType.jsonValuepyspark.sql.types.ShortType.simpleStringpyspark.sql.types.ShortType.typeNamepyspark.sql.types.StringType.jsonpyspark.sql.types.StringType.jsonValuepyspark.sql.types.StringType.simpleStringpyspark.sql.types.StringType.typeNamepyspark.sql.types.StructType.jsonpyspark.sql.types.StructType.jsonValuepyspark.sql.types.StructType.simpleStringpyspark.sql.types.StructType.typeNamepyspark.sql.types.TimestampType.jsonpyspark.sql.types.TimestampType.jsonValuepyspark.sql.types.TimestampType.simpleStringpyspark.sql.types.TimestampType.typeNamepyspark.sql.types.StructField.simpleStringpyspark.sql.types.StructField.typeNamepyspark.sql.types.StructField.jsonpyspark.sql.types.StructField.jsonValuepyspark.sql.types.DataType.jsonpyspark.sql.types.DataType.jsonValuepyspark.sql.types.DataType.simpleStringpyspark.sql.types.DataType.typeNamepyspark.sql.session.SparkSession.getActiveSessionpyspark.sql.session.SparkSession.versionpandas.io.html.read_htmlpandas.io.json._normalize.json_normalizepyspark.sql.types.ArrayType.fromJsonpyspark.sql.types.MapType.fromJsonpyspark.sql.types.StructField.fromJsonpyspark.sql.types.StructType.fromJsonpandas.core.groupby.generic.DataFrameGroupBy.pct_changepandas.core.groupby.generic.SeriesGroupBy.pct_change
Updated the mapping status for the following Pandas elements, from NotSupported to Direct
pandas.io.html.read_htmlpandas.io.json._normalize.json_normalizepandas.core.groupby.generic.DataFrameGroupBy.pct_changepandas.core.groupby.generic.SeriesGroupBy.pct_change
Updated the mapping status for the following PySpark elements, from Rename to Direct
pyspark.sql.functions.collect_listpyspark.sql.functions.size
Fixed ¶
Standardized the format of the version number in the inventories.
Version 2.5.2 (Feb 5, 2025)¶
Hotfix: Application & CLI Version 2.5.2¶
Desktop App¶
Fixed an issue when converting in the sample project option.
Included SMA Core Versions¶
Snowpark Conversion Core 5.3.0
Version 2.5.1 (Feb 4, 2025)¶
Application & CLI Version 2.5.1¶
Desktop App¶
Added a new modal when the user does not have write permission.
Updated the licensing aggrement, acceptance is required.
CLI¶
Fixed the year in the CLI screen when showing “–version” or “-v”
Included SMA Core Versions included-sma-core-versions¶
Snowpark Conversion Core 5.3.0
Added¶
Added the following Python Third-Party libraries with Direct status:
about-timeaffinegapaiohappyeyeballsalibi-detectalive-progressallure-nose2allure-robotframeworkanaconda-cloud-clianaconda-mirrorastropy-iers-dataasynchasyncsshautotsautovimlaws-msk-iam-sasl-signer-pythonazure-functionsbackports.tarfileblasbottlebsoncairocapnprotocaptumcategorical-distancecensusclickhouse-driverclustergramcmaconda-anaconda-telemetryconfigspacecpp-expecteddask-exprdata-science-utilsdatabricks-sdkdatetime-distancedb-dtypesdedupededupe-variable-datetimededupe_lehvenshtein_searchdedupe_levenshtein_searchdiff-coverdiptestdmglibdocstring_parserdoublemetaphonedspy-aieconmlemceeemojienvironseth-abieth-hasheth-typingeth-utilsexpatfiletypefitterflask-corsfpdf2frozendictgcabgeojsongettextglib-toolsgoogle-adsgoogle-ai-generativelanguagegoogle-api-python-clientgoogle-auth-httplib2google-cloud-bigquerygoogle-cloud-bigquery-coregoogle-cloud-bigquery-storagegoogle-cloud-bigquery-storage-coregoogle-cloud-resource-managergoogle-generativeaigooglemapsgraphemegraphenegraphql-relaygravisgreykitegrpc-google-iam-v1harfbuzzhatch-fancy-pypi-readmehaversinehiclasshicolor-icon-themehigheredhmmlearnholidays-exthttplib2icuimbalanced-ensembleimmutabledictimportlib-metadataimportlib-resourcesinquirerpyiterative-telemetryjaraco.contextjaraco.testjiterjiwerjoserfcjsoncppjsonpathjsonpath-ngjsonpath-pythonkagglehubkeplerglkt-legacylangchain-communitylangchain-experimentallangchain-snowflakelangchain-text-splitterslibabseillibflaclibgfortran-nglibgfortran5libgliblibgomplibgrpclibgsflibmagiclibogglibopenblaslibpostallibprotobuflibsentencepiecelibsndfilelibstdcxx-nglibtheoralibtifflibvorbislibwebplightweight-mmmlitestarlitestar-with-annotated-typeslitestar-with-attrslitestar-with-cryptographylitestar-with-jinjalitestar-with-jwtlitestar-with-prometheuslitestar-with-structloglunarcalendar-extmatplotlib-vennmetricksmimesismodin-raymomepympg123msgspecmsgspec-tomlmsgspec-yamlmsitoolsmultipartnamexnbconvert-allnbconvert-corenbconvert-pandocnlohmann_jsonnumba-cudanumpyrooffice365-rest-python-clientopenapi-pydanticopentelemetry-distroopentelemetry-instrumentationopentelemetry-instrumentation-system-metricsoptreeosmnxpathlibpdf2imagepfzypgpyplumbumpm4pypolarspolyfactorypoppler-cpppostalpre-commitprompt-toolkitpropcachepy-partiql-parserpy_stringmatchingpyatlanpyfakefspyfhelpyhacrf-datamadepyicebergpykrb5pylbfgspymilvuspymoopynisherpyomopypdfpypdf-with-cryptopypdf-with-fullpypdf-with-imagepypngpyprindpyrfrpysoundfilepytest-codspeedpytest-triopython-barcodepython-boxpython-docxpython-gssapipython-iso639python-magicpython-pandocpython-zstdpyucapyvinecopulibpyxirrqrcoderai-sdkray-clientray-observabilityreadlinerich-clickrouge-scoreruffscikit-criteriascikit-mobilitysentencepiece-pythonsentencepiece-spmsetuptools-markdownsetuptools-scmsetuptools-scm-git-archiveshareplumsimdjsonsimplecosinesis-extrasslack-sdksmacsnowflake-sqlalchemysnowflake_legacysocrata-pyspdlogsphinxcontrib-imagessphinxcontrib-jquerysphinxcontrib-youtubesplunk-opentelemetrysqlfluffsquarifyst-themestatisticsstreamlit-antd-componentsstreamlit-condition-treestreamlit-echartsstreamlit-feedbackstreamlit-keplerglstreamlit-mermaidstreamlit-navigation-barstreamlit-option-menustrictyamlstringdistsybiltensorflow-cputensorflow-texttiledb-ptorchaudiotorchevaltrio-websockettrulens-connectors-snowflaketrulens-coretrulens-dashboardtrulens-feedbacktrulens-otel-semconvtrulens-providers-cortextsdownsampletypingtyping-extensionstyping_extensionsunittest-xml-reportinguritemplateusuuid6wfdbwsprotozlibzope.index
Added the following Python BuiltIn libraries with Direct status:
aifcarrayastasynchatasyncioasyncoreatexitaudioopbase64bdbbinasciibitsectbuiltinsbz2calendarcgicgitbchunkcmathcmdcodecodecscodeopcolorsyscompileallconcurrentcontextlibcontextvarscopycopyregcprofilecryptcsvctypescursesdbmdifflibdisdistutilsdoctestemailensurepipenumerrnofaulthandlerfcntlfilecmpfileinputfnmatchfractionsftplibfunctoolsgcgetoptgetpassgettextgraphlibgrpgziphashlibheapqhmachtmlhttpidlelibimaplibimghdrimpimportlibinspectipaddressitertoolskeywordlinecachelocalelzmamailboxmailcapmarshalmathmimetypesmmapmodulefindermsilibmultiprocessingnetrcnisnntplibnumbersoperatoroptparseossaudiodevpdbpicklepickletoolspipespkgutilplatformplistlibpoplibposixpprintprofilepstatsptypwdpy_compilepyclbrpydocqueuequoprirandomrereprlibresourcerlcompleterrunpyschedsecretsselectselectorsshelveshlexsignalsitesitecustomizesmtpdsmtplibsndhdrsocketsocketserverspwdsqlite3sslstatstringstringprepstructsubprocesssunausymtablesysconfigsyslogtabnannytarfiletelnetlibtempfiletermiostesttextwrapthreadingtimeittkintertokentokenizetomllibtracetracebacktracemallocttyturtleturtledemotypesunicodedataurllibuuuuidvenvwarningswaveweakrefwebbrowserwsgirefxdrlibxmlxmlrpczipappzipfilezipimportzoneinfo
Added the following Python BuiltIn libraries with NotSupported status:
msvcrtwinregwinsound
Changed¶
Update .NET version to v9.0.0.
Improved EWI SPRKPY1068.
Bumped the version of Snowpark Python API supported by the SMA from 1.24.0 to 1.25.0.
Updated the detailed report template, now has the Snowpark version for Pandas.
Changed the following libraries from ThirdPartyLib to BuiltIn.
configparserdataclassespathlibreadlinestatisticszlib
Updated the mapping status for the following Pandas elements, from Direct to Partial:
pandas.core.frame.DataFrame.addpandas.core.frame.DataFrame.aggregatepandas.core.frame.DataFrame.allpandas.core.frame.DataFrame.applypandas.core.frame.DataFrame.astypepandas.core.frame.DataFrame.cumsumpandas.core.frame.DataFrame.divpandas.core.frame.DataFrame.dropnapandas.core.frame.DataFrame.eqpandas.core.frame.DataFrame.ffillpandas.core.frame.DataFrame.fillnapandas.core.frame.DataFrame.floordivpandas.core.frame.DataFrame.gepandas.core.frame.DataFrame.groupbypandas.core.frame.DataFrame.gtpandas.core.frame.DataFrame.idxmaxpandas.core.frame.DataFrame.idxminpandas.core.frame.DataFrame.infpandas.core.frame.DataFrame.joinpandas.core.frame.DataFrame.lepandas.core.frame.DataFrame.locpandas.core.frame.DataFrame.ltpandas.core.frame.DataFrame.maskpandas.core.frame.DataFrame.mergepandas.core.frame.DataFrame.modpandas.core.frame.DataFrame.mulpandas.core.frame.DataFrame.nepandas.core.frame.DataFrame.nuniquepandas.core.frame.DataFrame.pivot_tablepandas.core.frame.DataFrame.powpandas.core.frame.DataFrame.raddpandas.core.frame.DataFrame.rankpandas.core.frame.DataFrame.rdivpandas.core.frame.DataFrame.renamepandas.core.frame.DataFrame.replacepandas.core.frame.DataFrame.resamplepandas.core.frame.DataFrame.rfloordivpandas.core.frame.DataFrame.rmodpandas.core.frame.DataFrame.rmulpandas.core.frame.DataFrame.rollingpandas.core.frame.DataFrame.roundpandas.core.frame.DataFrame.rpowpandas.core.frame.DataFrame.rsubpandas.core.frame.DataFrame.rtruedivpandas.core.frame.DataFrame.shiftpandas.core.frame.DataFrame.skewpandas.core.frame.DataFrame.sort_indexpandas.core.frame.DataFrame.sort_valuespandas.core.frame.DataFrame.subpandas.core.frame.DataFrame.to_dictpandas.core.frame.DataFrame.transformpandas.core.frame.DataFrame.transposepandas.core.frame.DataFrame.truedivpandas.core.frame.DataFrame.varpandas.core.indexes.datetimes.date_rangepandas.core.reshape.concat.concatpandas.core.reshape.melt.meltpandas.core.reshape.merge.mergepandas.core.reshape.pivot.pivot_tablepandas.core.reshape.tile.cutpandas.core.series.Series.addpandas.core.series.Series.aggregatepandas.core.series.Series.allpandas.core.series.Series.anypandas.core.series.Series.cumsumpandas.core.series.Series.divpandas.core.series.Series.dropnapandas.core.series.Series.eqpandas.core.series.Series.ffillpandas.core.series.Series.fillnapandas.core.series.Series.floordivpandas.core.series.Series.gepandas.core.series.Series.gtpandas.core.series.Series.ltpandas.core.series.Series.maskpandas.core.series.Series.modpandas.core.series.Series.mulpandas.core.series.Series.multiplypandas.core.series.Series.nepandas.core.series.Series.powpandas.core.series.Series.quantilepandas.core.series.Series.raddpandas.core.series.Series.rankpandas.core.series.Series.rdivpandas.core.series.Series.renamepandas.core.series.Series.replacepandas.core.series.Series.resamplepandas.core.series.Series.rfloordivpandas.core.series.Series.rmodpandas.core.series.Series.rmulpandas.core.series.Series.rollingpandas.core.series.Series.rpowpandas.core.series.Series.rsubpandas.core.series.Series.rtruedivpandas.core.series.Series.samplepandas.core.series.Series.shiftpandas.core.series.Series.skewpandas.core.series.Series.sort_indexpandas.core.series.Series.sort_valuespandas.core.series.Series.stdpandas.core.series.Series.subpandas.core.series.Series.subtractpandas.core.series.Series.truedivpandas.core.series.Series.value_countspandas.core.series.Series.varpandas.core.series.Series.wherepandas.core.tools.numeric.to_numeric
Updated the mapping status for the following Pandas elements, from NotSupported to Direct:
pandas.core.frame.DataFrame.attrspandas.core.indexes.base.Index.to_numpypandas.core.series.Series.str.lenpandas.io.html.read_htmlpandas.io.xml.read_xmlpandas.core.indexes.datetimes.DatetimeIndex.meanpandas.core.resample.Resampler.indicespandas.core.resample.Resampler.nuniquepandas.core.series.Series.itemspandas.core.tools.datetimes.to_datetimepandas.io.sas.sasreader.read_saspandas.core.frame.DataFrame.attrspandas.core.frame.DataFrame.stylepandas.core.frame.DataFrame.itemspandas.core.groupby.generic.DataFrameGroupBy.headpandas.core.groupby.generic.DataFrameGroupBy.medianpandas.core.groupby.generic.DataFrameGroupBy.minpandas.core.groupby.generic.DataFrameGroupBy.nuniquepandas.core.groupby.generic.DataFrameGroupBy.tailpandas.core.indexes.base.Index.is_booleanpandas.core.indexes.base.Index.is_floatingpandas.core.indexes.base.Index.is_integerpandas.core.indexes.base.Index.is_monotonic_decreasingpandas.core.indexes.base.Index.is_monotonic_increasingpandas.core.indexes.base.Index.is_numericpandas.core.indexes.base.Index.is_objectpandas.core.indexes.base.Index.maxpandas.core.indexes.base.Index.minpandas.core.indexes.base.Index.namepandas.core.indexes.base.Index.namespandas.core.indexes.base.Index.renamepandas.core.indexes.base.Index.set_namespandas.core.indexes.datetimes.DatetimeIndex.day_namepandas.core.indexes.datetimes.DatetimeIndex.month_namepandas.core.indexes.datetimes.DatetimeIndex.timepandas.core.indexes.timedeltas.TimedeltaIndex.ceilpandas.core.indexes.timedeltas.TimedeltaIndex.dayspandas.core.indexes.timedeltas.TimedeltaIndex.floorpandas.core.indexes.timedeltas.TimedeltaIndex.microsecondspandas.core.indexes.timedeltas.TimedeltaIndex.nanosecondspandas.core.indexes.timedeltas.TimedeltaIndex.roundpandas.core.indexes.timedeltas.TimedeltaIndex.secondspandas.core.reshape.pivot.crosstabpandas.core.series.Series.dt.roundpandas.core.series.Series.dt.timepandas.core.series.Series.dt.weekdaypandas.core.series.Series.is_monotonic_decreasingpandas.core.series.Series.is_monotonic_increasing
Updated the mapping status for the following Pandas elements, from NotSupported to Partial:
pandas.core.frame.DataFrame.alignpandas.core.series.Series.alignpandas.core.frame.DataFrame.tz_convertpandas.core.frame.DataFrame.tz_localizepandas.core.groupby.generic.DataFrameGroupBy.fillnapandas.core.groupby.generic.SeriesGroupBy.fillnapandas.core.indexes.datetimes.bdate_rangepandas.core.indexes.datetimes.DatetimeIndex.stdpandas.core.indexes.timedeltas.TimedeltaIndex.meanpandas.core.resample.Resampler.asfreqpandas.core.resample.Resampler.quantilepandas.core.series.Series.mappandas.core.series.Series.tz_convertpandas.core.series.Series.tz_localizepandas.core.window.expanding.Expanding.countpandas.core.window.rolling.Rolling.countpandas.core.groupby.generic.DataFrameGroupBy.aggregatepandas.core.groupby.generic.SeriesGroupBy.aggregatepandas.core.frame.DataFrame.applymappandas.core.series.Series.applypandas.core.groupby.generic.DataFrameGroupBy.bfillpandas.core.groupby.generic.DataFrameGroupBy.ffillpandas.core.groupby.generic.SeriesGroupBy.bfillpandas.core.groupby.generic.SeriesGroupBy.ffillpandas.core.frame.DataFrame.backfillpandas.core.frame.DataFrame.bfillpandas.core.frame.DataFrame.comparepandas.core.frame.DataFrame.unstackpandas.core.frame.DataFrame.asfreqpandas.core.series.Series.backfillpandas.core.series.Series.bfillpandas.core.series.Series.comparepandas.core.series.Series.unstackpandas.core.series.Series.asfreqpandas.core.series.Series.argmaxpandas.core.series.Series.argminpandas.core.indexes.accessors.CombinedDatetimelikeProperties.microsecondpandas.core.indexes.accessors.CombinedDatetimelikeProperties.nanosecondpandas.core.indexes.accessors.CombinedDatetimelikeProperties.day_namepandas.core.indexes.accessors.CombinedDatetimelikeProperties.month_namepandas.core.indexes.accessors.CombinedDatetimelikeProperties.month_startpandas.core.indexes.accessors.CombinedDatetimelikeProperties.month_endpandas.core.indexes.accessors.CombinedDatetimelikeProperties.is_year_startpandas.core.indexes.accessors.CombinedDatetimelikeProperties.is_year_endpandas.core.indexes.accessors.CombinedDatetimelikeProperties.is_quarter_startpandas.core.indexes.accessors.CombinedDatetimelikeProperties.is_quarter_endpandas.core.indexes.accessors.CombinedDatetimelikeProperties.is_leap_yearpandas.core.indexes.accessors.CombinedDatetimelikeProperties.floorpandas.core.indexes.accessors.CombinedDatetimelikeProperties.ceilpandas.core.groupby.generic.DataFrameGroupBy.idxmaxpandas.core.groupby.generic.DataFrameGroupBy.idxminpandas.core.groupby.generic.DataFrameGroupBy.stdpandas.core.indexes.timedeltas.TimedeltaIndex.meanpandas.core.tools.timedeltas.to_timedelta
Known Issue¶
This version includes an issue when converting the sample project will not work on this version, it will be fixed on the next release
Version 2.4.3 (Jan 9, 2025)¶
Application & CLI Version 2.4.3¶
Desktop App¶
Added link to the troubleshooting guide in the crash report modal.
Included SMA Core Versions¶
Snowpark Conversion Core 4.15.0
Added¶
Added the following PySpark elements to ConversionStatusPySpark.csv file as
NotSupported:pyspark.sql.streaming.readwriter.DataStreamReader.tablepyspark.sql.streaming.readwriter.DataStreamReader.schemapyspark.sql.streaming.readwriter.DataStreamReader.optionspyspark.sql.streaming.readwriter.DataStreamReader.optionpyspark.sql.streaming.readwriter.DataStreamReader.loadpyspark.sql.streaming.readwriter.DataStreamReader.formatpyspark.sql.streaming.query.StreamingQuery.awaitTerminationpyspark.sql.streaming.readwriter.DataStreamWriter.partitionBypyspark.sql.streaming.readwriter.DataStreamWriter.toTablepyspark.sql.streaming.readwriter.DataStreamWriter.triggerpyspark.sql.streaming.readwriter.DataStreamWriter.queryNamepyspark.sql.streaming.readwriter.DataStreamWriter.outputModepyspark.sql.streaming.readwriter.DataStreamWriter.formatpyspark.sql.streaming.readwriter.DataStreamWriter.optionpyspark.sql.streaming.readwriter.DataStreamWriter.foreachBatchpyspark.sql.streaming.readwriter.DataStreamWriter.start
Changed¶
Updated Hive SQL EWIs format.
SPRKHVSQL1001
SPRKHVSQL1002
SPRKHVSQL1003
SPRKHVSQL1004
SPRKHVSQL1005
SPRKHVSQL1006
Updated Spark SQL EWIs format.
SPRKSPSQL1001
SPRKSPSQL1002
SPRKSPSQL1003
SPRKSPSQL1004
SPRKSPSQL1005
SPRKSPSQL1006
Fixed¶
Fixed a bug that was causing some PySpark elements not identified by the tool.
Fixed the mismatch in the ThirdParty identified calls and the ThirdParty import Calls number.
Version 2.4.2 (Dec 13, 2024)¶
Application & CLI Version 2.4.2¶
Included SMA Core Versions¶
Snowpark Conversion Core 4.14.0
Added added¶
Added the following Spark elements to ConversionStatusPySpark.csv:
pyspark.broadcast.Broadcast.valuepyspark.conf.SparkConf.getAllpyspark.conf.SparkConf.setAllpyspark.conf.SparkConf.setMasterpyspark.context.SparkContext.addFilepyspark.context.SparkContext.addPyFilepyspark.context.SparkContext.binaryFilespyspark.context.SparkContext.setSystemPropertypyspark.context.SparkContext.versionpyspark.files.SparkFilespyspark.files.SparkFiles.getpyspark.rdd.RDD.countpyspark.rdd.RDD.distinctpyspark.rdd.RDD.reduceByKeypyspark.rdd.RDD.saveAsTextFilepyspark.rdd.RDD.takepyspark.rdd.RDD.zipWithIndexpyspark.sql.context.SQLContext.udfpyspark.sql.types.StructType.simpleString
Changed¶
Updated the documentation of the Pandas EWIs,
PNDSPY1001,PNDSPY1002andPNDSPY1003SPRKSCL1137to align with a standardized format, ensuring consistency and clarity across all the EWIs.Updated the documentation of the following Scala EWIs:
SPRKSCL1106andSPRKSCL1107. To be aligned with a standardized format, ensuring consistency and clarity across all the EWIs.
Fixed¶
Fixed the bug the was causing the UserDefined symbols showing in the third party usages inventory.
Version 2.4.1 (Dec 4, 2024)¶
Application & CLI Version 2.4.1¶
Included SMA Core Versions¶
Snowpark Conversion Core 4.13.1
Command Line Interface¶
Changed
Added timestamp to the output folder.
Snowpark Conversion Core 4.13.1¶
Added¶
Added ‘Source Language’ column to Library Mappings Table
Added
Othersas a new category in the Pandas API Summary table of the DetailedReport.docx
Changed¶
Updated the documentation for Python EWI
SPRKPY1058.Updated the message for the pandas EWI
PNDSPY1002to show the relate pandas element.Updated the way we created the .csv reports, now are overwritten after a second run .
Fixed¶
Fixed a bug that was causing Notebook files not being generated in the output.
Fixed the replacer for
getandsetmethods frompyspark.sql.conf.RuntimeConfig, the replacer now match the correct full names.Fixed query tag incorrect version.
Fixed UserDefined packages reported as ThirdPartyLib.
\
Version 2.3.1 (Nov 14, 2024)¶
Application & CLI Version 2.3.1¶
Included SMA Core Versions¶
Snowpark Conversion Core 4.12.0
Desktop App¶
Fixed
Fix case-sensitive issues in –sql options.
Removed
Remove platform name from show-ac message.
Snowpark Conversion Core 4.12.0¶
Added¶
Added support for Snowpark Python 1.23.0 and 1.24.0.
Added a new EWI for the
pyspark.sql.dataframe.DataFrame.writeTofunction. All the usages of this function will now have the EWI SPRKPY1087.
Changed¶
Updated the documentation of the Scala EWIs from
SPRKSCL1137toSPRKSCL1156to align with a standardized format, ensuring consistency and clarity across all the EWIs.Updated the documentation of the Scala EWIs from
SPRKSCL1117toSPRKSCL1136to align with a standardized format, ensuring consistency and clarity across all the EWIs.Updated the message that is shown for the following EWIs:
SPRKPY1082
SPRKPY1083
Updated the documentation of the Scala EWIs from
SPRKSCL1100toSPRKSCL1105, fromSPRKSCL1108toSPRKSCL1116; fromSPRKSCL1157toSPRKSCL1175; to align with a standardized format, ensuring consistency and clarity across all the EWIs.Updated the mapping status of the following PySpark elements from NotSupported to Direct with EWI:
pyspark.sql.readwriter.DataFrameWriter.option=>snowflake.snowpark.DataFrameWriter.option: All the usages of this function now have the EWI SPRKPY1088pyspark.sql.readwriter.DataFrameWriter.options=>snowflake.snowpark.DataFrameWriter.options: All the usages of this function now have the EWI SPRKPY1089
Updated the mapping status of the following PySpark elements from Workaround to Rename:
pyspark.sql.readwriter.DataFrameWriter.partitionBy=>snowflake.snowpark.DataFrameWriter.partition_by
Updated EWI documentation: SPRKSCL1000, SPRKSCL1001, SPRKSCL1002, SPRKSCL1100, SPRKSCL1101, SPRKSCL1102, SPRKSCL1103, SPRKSCL1104, SPRKSCL1105.
Removed¶
Removed the
pyspark.sql.dataframe.DataFrameStatFunctions.writeToelement from the conversion status, this element does not exist.
Deprecated¶
Deprecated the following EWI codes:
SPRKPY1081
SPRKPY1084
Version 2.3.0 (Oct 30, 2024)¶
Application & CLI Version 2.3.0¶
Snowpark Conversion Core 4.11.0
Snowpark Conversion Core 4.11.0¶
Added¶
Added a new column called
Urlto theIssues.csvfile, which redirects to the corresponding EWI documentation.Added new EWIs for the following Spark elements:
[SPRKPY1082] pyspark.sql.readwriter.DataFrameReader.load
[SPRKPY1083] pyspark.sql.readwriter.DataFrameWriter.save
[SPRKPY1084] pyspark.sql.readwriter.DataFrameWriter.option
[SPRKPY1085] pyspark.ml.feature.VectorAssembler
[SPRKPY1086] pyspark.ml.linalg.VectorUDT
Added 38 new Pandas elements:
pandas.core.frame.DataFrame.select
andas.core.frame.DataFrame.str
pandas.core.frame.DataFrame.str.replace
pandas.core.frame.DataFrame.str.upper
pandas.core.frame.DataFrame.to_list
pandas.core.frame.DataFrame.tolist
pandas.core.frame.DataFrame.unique
pandas.core.frame.DataFrame.values.tolist
pandas.core.frame.DataFrame.withColumn
pandas.core.groupby.generic._SeriesGroupByScalar
pandas.core.groupby.generic._SeriesGroupByScalar[S1].agg
pandas.core.groupby.generic._SeriesGroupByScalar[S1].aggregate
pandas.core.indexes.datetimes.DatetimeIndex.year
pandas.core.series.Series.columns
pandas.core.tools.datetimes.to_datetime.date
pandas.core.tools.datetimes.to_datetime.dt.strftime
pandas.core.tools.datetimes.to_datetime.strftime
pandas.io.parsers.readers.TextFileReader.apply
pandas.io.parsers.readers.TextFileReader.astype
pandas.io.parsers.readers.TextFileReader.columns
pandas.io.parsers.readers.TextFileReader.copy
pandas.io.parsers.readers.TextFileReader.drop
pandas.io.parsers.readers.TextFileReader.drop_duplicates
pandas.io.parsers.readers.TextFileReader.fillna
pandas.io.parsers.readers.TextFileReader.groupby
pandas.io.parsers.readers.TextFileReader.head
pandas.io.parsers.readers.TextFileReader.iloc
pandas.io.parsers.readers.TextFileReader.isin
pandas.io.parsers.readers.TextFileReader.iterrows
pandas.io.parsers.readers.TextFileReader.loc
pandas.io.parsers.readers.TextFileReader.merge
pandas.io.parsers.readers.TextFileReader.rename
pandas.io.parsers.readers.TextFileReader.shape
pandas.io.parsers.readers.TextFileReader.to_csv
pandas.io.parsers.readers.TextFileReader.to_excel
pandas.io.parsers.readers.TextFileReader.unique
pandas.io.parsers.readers.TextFileReader.values
pandas.tseries.offsets
Version 2.2.3 (Oct 24, 2024)¶
Application Version 2.2.3¶
Included SMA Core Versions¶
Snowpark Conversion Core 4.10.0
Desktop App¶
Fixed¶
Fixed a bug that caused the SMA to show the label SnowConvert instead of Snowpark Migration Accelerator in the menu bar of the Windows version.
Fixed a bug that caused the SMA to crash when it did not have read and write permissions to the
.configdirectory in macOS and theAppDatadirectory in Windows.
Command Line Interface¶
Changed
Renamed the CLI executable name from
snowcttosma.Removed the source language argument so you no longer need to specify if you are running a Python or Scala assessment / conversion.
Expanded the command line arguments supported by the CLI by adding the following new arguments:
--enableJupyter|-j: Flag to indicate if the conversion of Databricks notebooks to Jupyter is enabled or not.--sql|-f: Database engine syntax to be used when a SQL command is detected.--customerEmail|-e: Configure the customer email.--customerCompany|-c: Configure the customer company.--projectName|-p: Configure the customer project.
Updated some texts to reflect the correct name of the application, ensuring consistency and clarity in all the messages.
Updated the terms of use of the application.
Updated and expanded the documentation of the CLI to reflect the latests features, enhancements and changes.
Updated the text that is shown before proceeding with the execution of the SMA to improve
Updated the CLI to accept “Yes” as a valid argument when prompting for user confirmation.
Allowed the CLI to continue the execution without waiting for user interaction by specifying the argument
-yor--yes.Updated the help information of the
--sqlargument to show the values that this argument expects.
Snowpark Conversion Core Version 4.10.0¶
Added¶
Added a new EWI for the
pyspark.sql.readwriter.DataFrameWriter.partitionByfunction. All the usages of this function will now have the EWI SPRKPY1081.Added a new column called
Technologyto theImportUsagesInventory.csvfile.
Changed¶
Updated the Third-Party Libraries readiness score to also take into account the
Unknownlibraries.Updated the
AssessmentFiles.zipfile to include.jsonfiles instead of.pamfiles.Improved the CSV to JSON conversion mechanism to make processing of inventories more performant.
Improved the documentation of the following EWIs:
SPRKPY1029
SPRKPY1054
SPRKPY1055
SPRKPY1063
SPRKPY1075
SPRKPY1076
Updated the mapping status of the following Spark Scala elements from
DirecttoRename.org.apache.spark.sql.functions.shiftLeft=>com.snowflake.snowpark.functions.shiftleftorg.apache.spark.sql.functions.shiftRight=>com.snowflake.snowpark.functions.shiftright
Updated the mapping status of the following Spark Scala elements from
Not SupportedtoDirect.org.apache.spark.sql.functions.shiftleft=>com.snowflake.snowpark.functions.shiftleftorg.apache.spark.sql.functions.shiftright=>com.snowflake.snowpark.functions.shiftright
Fixed¶
Fixed a bug that caused the SMA to incorrectly populate the
Origincolumn of theImportUsagesInventory.csvfile.Fixed a bug that caused the SMA to not classify imports of the libraries
io,json,loggingandunittestas Python built-in imports in theImportUsagesInventory.csvfile and in theDetailedReport.docxfile.
Version 2.2.2 (Oct 11, 2024)¶
Application Version 2.2.2¶
Features Updates include:
Snowpark Conversion Core 4.8.0
Snowpark Conversion Core Version 4.8.0¶
Added¶
Added
EwiCatalog.csvand .md files to reorganize documentationAdded the mapping status of
pyspark.sql.functions.lnDirect.Added a transformation for
pyspark.context.SparkContext.getOrCreatePlease check the EWI SPRKPY1080 for further details.
Added an improvement for the SymbolTable, infer type for parameters in functions.
Added SymbolTable supports static methods and do not assume the first parameter will be self for them.
Added documentation for missing EWIs
SPRKHVSQL1005
SPRKHVSQL1006
SPRKSPSQL1005
SPRKSPSQL1006
SPRKSCL1002
SPRKSCL1170
SPRKSCL1171
SPRKPY1057
SPRKPY1058
SPRKPY1059
SPRKPY1060
SPRKPY1061
SPRKPY1064
SPRKPY1065
SPRKPY1066
SPRKPY1067
SPRKPY1069
SPRKPY1070
SPRKPY1077
SPRKPY1078
SPRKPY1079
SPRKPY1101
Changed¶
Updated the mapping status of:
pyspark.sql.functions.array_removefromNotSupportedtoDirect.
Fixed¶
Fixed the Code File Sizing table in the Detail Report to exclude .sql and .hql files and added the Extra Large row in the table.
Fixed missing the
update_query_tagwhenSparkSessionis defined into multiple lines onPython.Fixed missing the
update_query_tagwhenSparkSessionis defined into multiple lines onScala.Fixed missing EWI
SPRKHVSQL1001to some SQL statements with parsing errors.Fixed keep new lines values inside string literals
Fixed the Total Lines of code showed in the File Type Summary Table
Fixed Parsing Score showed as 0 when recognize files successfully
Fixed LOC count in the cell inventory for Databricks Magic SQL Cells
Version 2.2.0 (Sep 26, 2024)¶
Application Version 2.2.0¶
Feature Updates include:
Snowpark Conversion Core 4.6.0
Snowpark Conversion Core Version 4.6.0¶
Added¶
Add transformation for
pyspark.sql.readwriter.DataFrameReader.parquet.Add transformation for
pyspark.sql.readwriter.DataFrameReader.optionwhen it is a Parquet method.
Changed¶
Updated the mapping status of:
pyspark.sql.types.StructType.fieldsfromNotSupportedtoDirect.pyspark.sql.types.StructType.namesfromNotSupportedtoDirect.pyspark.context.SparkContext.setLogLevelfromWorkaroundtoTransformation.More detail can be found in EWIs SPRKPY1078 and SPRKPY1079
org.apache.spark.sql.functions.roundfromWorkAroundtoDirect.org.apache.spark.sql.functions.udffromNotDefinedtoTransformation.More detail can be found in EWIs SPRKSCL1174 and SPRKSCL1175
Updated the mapping status of the following Spark elements from
DirectHelpertoDirect:org.apache.spark.sql.functions.hexorg.apache.spark.sql.functions.unhexorg.apache.spark.sql.functions.shiftleftorg.apache.spark.sql.functions.shiftrightorg.apache.spark.sql.functions.reverseorg.apache.spark.sql.functions.isnullorg.apache.spark.sql.functions.unix_timestamporg.apache.spark.sql.functions.randnorg.apache.spark.sql.functions.signumorg.apache.spark.sql.functions.signorg.apache.spark.sql.functions.collect_listorg.apache.spark.sql.functions.log10org.apache.spark.sql.functions.log1porg.apache.spark.sql.functions.base64org.apache.spark.sql.functions.unbase64org.apache.spark.sql.functions.regexp_extractorg.apache.spark.sql.functions.exprorg.apache.spark.sql.functions.date_formatorg.apache.spark.sql.functions.descorg.apache.spark.sql.functions.ascorg.apache.spark.sql.functions.sizeorg.apache.spark.sql.functions.locateorg.apache.spark.sql.functions.ntile
Fixed¶
Fixed value showed in the Percentage of total Pandas Api
Fixed Total percentage on ImportCalls table in the DetailReport
Deprecated¶
Deprecated the following EWI code:
SPRKSCL1115
Version 2.1.7 (Sep 12, 2024)¶
Application Version 2.1.7¶
Feature Updates include:
Snowpark Conversion Core 4.5.7
Snowpark Conversion Core 4.5.2
Snowpark Conversion Core Version 4.5.7¶
Hotfixed¶
Fixed Total row added on Spark Usages Summaries when there are not usages
Bumped of Python Assembly to Version=
1.3.111Parse trail comma in multiline arguments
Snowpark Conversion Core Version 4.5.2¶
Added¶
Added transformation for
pyspark.sql.readwriter.DataFrameReader.option:When the chain is from a CSV method call.
When the chain is from a JSON method call.
Added transformation for
pyspark.sql.readwriter.DataFrameReader.json.
Changed¶
Executed SMA on SQL strings passed to Python/Scala functions
Create AST in Scala/Python to emit temporary SQL unit
Create SqlEmbeddedUsages.csv inventory
Deprecate SqlStatementsInventroy.csv and SqlExtractionInventory.csv
Integrate EWI when the SQL literal could not be processed
Create new task to process SQL-embedded code
Collect info for SqlEmbeddedUsages.csv inventory in Python
Replace SQL transformed code to Literal in Python
Update test cases after implementation
Create table, views for telemetry in SqlEmbeddedUsages inventory
Collect info for SqlEmbeddedUsages.csv report in Scala
Replace SQL transformed code to Literal in Scala
Check line number order for Embedded SQL reporting
Filled the
SqlFunctionsInfo.csvwith the SQL functions documented for SparkSQL and HiveSQLUpdated the mapping status for:
org.apache.spark.sql.SparkSession.sparkContextfrom NotSupported to Transformation.org.apache.spark.sql.Builder.configfromNotSupportedtoTransformation. With this new mapping status, the SMA will remove all the usages of this function from the source code.
Version 2.1.6 (Sep 5, 2024)¶
Application Version 2.1.6¶
Hotfix change for Snowpark Engines Core version 4.5.1
Spark Conversion Core Version 4.5.1¶
Hotfix
Added a mechanism to convert the temporal Databricks notebooks generated by SMA in exported Databricks notebooks
Version 2.1.5 (Aug 29, 2024)¶
Application Version 2.1.5¶
Feature Updates include:
Updated Spark Conversion Core: 4.3.2
Spark Conversion Core Version 4.3.2¶
Added¶
Added the mechanism (via decoration) to get the line and the column of the elements identified in notebooks cells
Added an EWI for pyspark.sql.functions.from_json.
Added a transformation for pyspark.sql.readwriter.DataFrameReader.csv.
Enabled the query tag mechanism for Scala files.
Added the Code Analysis Score and additional links to the Detailed Report.
Added a column called OriginFilePath to InputFilesInventory.csv
Changed¶
Updated the mapping status of pyspark.sql.functions.from_json from Not Supported to Transformation.
Updated the mapping status of the following Spark elements from Workaround to Direct:
org.apache.spark.sql.functions.countDistinct
org.apache.spark.sql.functions.max
org.apache.spark.sql.functions.min
org.apache.spark.sql.functions.mean
Deprecated¶
Deprecated the following EWI codes:
SPRKSCL1135
SPRKSCL1136
SPRKSCL1153
SPRKSCL1155
Fixed¶
Fixed a bug that caused an incorrect calculation of the Spark API score.
Fixed an error that avoid copy SQL empty or commented files in the output folder.
Fixed a bug in the DetailedReport, the notebook stats LOC and Cell count is not accurate.
Version 2.1.2 (Aug 14, 2024)¶
Application Version 2.1.2¶
Feature Updates include:
Updated Spark Conversion Core: 4.2.0
Spark Conversion Core Version 4.2.0¶
Added¶
Add technology column to SparkUsagesInventory
Added an EWI for not defined SQL elements .
Added SqlFunctions Inventory
Collect info for SqlFunctions Inventory
Changed¶
The engine now processes and prints partially parsed Python files instead of leaving original file without modifications.
Python notebook cells that have parsing errors will also be processed and printed.
Fixed¶
Fixed
pandas.core.indexes.datetimes.DatetimeIndex.strftimewas being reported wrongly.Fix mismatch between SQL readiness score and SQL Usages by Support Status.
Fixed a bug that caused the SMA to report
pandas.core.series.Series.emptywith an incorrect mapping status.Fix mismatch between Spark API Usages Ready for Conversion in DetailedReport.docx is different than UsagesReadyForConversion row in Assessment.json.
Version 2.1.1 (Aug 8, 2024)¶
Application Version 2.1.1¶
Feature Updates include:
Updated Spark Conversion Core: 4.1.0
Spark Conversion Core Version 4.1.0¶
Added¶
Added the following information to the
AssessmentReport.jsonfileThe third-party libraries readiness score.
The number of third-party library calls that were identified.
The number of third-party library calls that are supported in Snowpark.
The color code associated with the third-party readiness score, the Spark API readiness score, and the SQL readiness score.
Transformed
SqlSimpleDataTypein Spark create tables.Added the mapping of
pyspark.sql.functions.getas direct.Added the mapping of
pyspark.sql.functions.to_varcharas direct.As part of the changes after unification, the tool now generates an execution info file in the Engine.
Added a replacer for
pyspark.sql.SparkSession.builder.appName.
Changed¶
Updated the mapping status for the following Spark elements
From Not Supported to Direct mapping:
pyspark.sql.functions.signpyspark.sql.functions.signum
Changed the Notebook Cells Inventory report to indicate the kind of content for every cell in the column Element
Added a
SCALA_READINESS_SCOREcolumn that reports the readiness score as related only to references to the Spark API in Scala files.Partial support to transform table properties in
ALTER TABLEandALTER VIEWUpdated the conversion status of the node
SqlSimpleDataTypefrom Pending to Transformation in Spark create tablesUpdated the version of the Snowpark Scala API supported by the SMA from
1.7.0to1.12.1:Updated the mapping status of:
org.apache.spark.sql.SparkSession.getOrCreatefrom Rename to Directorg.apache.spark.sql.functions.sumfrom Workaround to Direct
Updated the version of the Snowpark Python API supported by the SMA from
1.15.0to1.20.0:Updated the mapping status of:
pyspark.sql.functions.arrays_zipfrom Not Supported to Direct
Updated the mapping status for the following Pandas elements:
Direct mappings:
pandas.core.frame.DataFrame.anypandas.core.frame.DataFrame.applymap
Updated the mapping status for the following Pandas elements:
From Not Supported to Direct mapping:
pandas.core.frame.DataFrame.groupbypandas.core.frame.DataFrame.indexpandas.core.frame.DataFrame.Tpandas.core.frame.DataFrame.to_dict
From Not Supported to Rename mapping:
pandas.core.frame.DataFrame.map
Updated the mapping status for the following Pandas elements:
Direct mappings:
pandas.core.frame.DataFrame.wherepandas.core.groupby.generic.SeriesGroupBy.aggpandas.core.groupby.generic.SeriesGroupBy.aggregatepandas.core.groupby.generic.DataFrameGroupBy.aggpandas.core.groupby.generic.DataFrameGroupBy.aggregatepandas.core.groupby.generic.DataFrameGroupBy.apply
Not Supported mappings:
pandas.core.frame.DataFrame.to_parquetpandas.core.generic.NDFrame.to_csvpandas.core.generic.NDFrame.to_excelpandas.core.generic.NDFrame.to_sql
Updated the mapping status for the following Pandas elements:
Direct mappings:
pandas.core.series.Series.emptypandas.core.series.Series.applypandas.core.reshape.tile.qcut
Direct mappings with EWI:
pandas.core.series.Series.fillnapandas.core.series.Series.astypepandas.core.reshape.melt.meltpandas.core.reshape.tile.cutpandas.core.reshape.pivot.pivot_table
Updated the mapping status for the following Pandas elements:
Direct mappings:
pandas.core.series.Series.dtpandas.core.series.Series.groupbypandas.core.series.Series.locpandas.core.series.Series.shapepandas.core.tools.datetimes.to_datetimepandas.io.excel._base.ExcelFile
Not Supported mappings:
pandas.core.series.Series.dt.strftime
Updated the mapping status for the following Pandas elements:
From Not Supported to Direct mapping:
pandas.io.parquet.read_parquetpandas.io.parsers.readers.read_csv
Updated the mapping status for the following Pandas elements:
From Not Supported to Direct mapping:
pandas.io.pickle.read_picklepandas.io.sql.read_sqlpandas.io.sql.read_sql_query
Updated the description of Understanding the SQL Readiness Score.
Updated
PyProgramCollectorto collect the packages and populate the current packages inventory with data from Python source code.Updated the mapping status of
pyspark.sql.SparkSession.builder.appNamefrom Rename to Transformation.Removed the following Scala integration tests:
AssesmentReportTest_AssessmentMode.ValidateReports_AssessmentModeAssessmentReportTest_PythonAndScala_Files.ValidateReports_PythonAndScalaAssessmentReportTestWithoutSparkUsages.ValidateReports_WithoutSparkUsages
Updated the mapping status of
pandas.core.generic.NDFrame.shapefrom Not Supported to Direct.Updated the mapping status of
pandas.core.seriesfrom Not Supported to Direct.
Deprecated¶
Deprecated the EWI code
SPRKSCL1160sinceorg.apache.spark.sql.functions.sumis now a direct mapping.
Fixed¶
Fixed a bug by not supporting Custom Magics without arguments in Jupyter Notebook cells.
Fixed incorrect generation of EWIs in the issues.csv report when parsing errors occur.
Fixed a bug that caused the SMA not to process the Databricks exported notebook as Databricks notebooks.
Fixed a stack overflow error while processing clashing type names of declarations created inside package objects.
Fixed the processing of complex lambda type names involving generics, e.g.,
def func[X,Y](f: (Map[Option[X], Y] => Map[Y, X]))...Fixed a bug that caused the SMA to add a PySpark EWI code instead of a Pandas EWI code to the Pandas elements that are not yet recognized.
Fixed a typo in the detailed report template: renaming a column from “Percentage of all Python Files” to “Percentage of all files”.
Fixed a bug where
pandas.core.series.Series.shapewas wrongly reported.